DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT1B and or90h4

DIOPT Version :9

Sequence 1:NP_001137708.2 Gene:5-HT1B / 37191 FlyBaseID:FBgn0263116 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001129719.1 Gene:or90h4 / 556415 ZFINID:ZDB-GENE-070806-23 Length:315 Species:Danio rerio


Alignment Length:267 Identity:52/267 - (19%)
Similarity:111/267 - (41%) Gaps:60/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TTSNLSQIVWNRSINGNGNSNTFDLVDDEQERAAVEFWLLVKMIAMAVVLGLMILVTIIGNVFVI 112
            :::.::..||              :||:.||       .:.|.|   |::.|.::|.:|..:.|:
Zfish     7 SSTEMNTTVW--------------IVDNYQE-------AITKHI---VIVFLALIVNVINGMLVV 47

  Fly   113 ---AAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISN-GWILGPELCDIWTSCDVLC 173
               ::.:..|:.:.:   |...|.:.|:.:.|..:   |:|.::. ..::...||.|..|...:.
Zfish    48 TFFSSHVFSRDSRYI---LYIHLVINDMLMICASV---AIYVLTYIAPVVNASLCYILMSLGKVF 106

  Fly   174 CTASILHLVAIAADRYWTVTN-IDYNNLRTPRRVFLMIFCVWFAA-------LIVSLAPQ----- 225
            ...:.|:|..:|.:|:..|.. :.::.:.||:|.::....:|..|       :::||..|     
Zfish   107 FMITPLNLAGMAIERFIAVCKPLHHSQICTPQRTYVFFCLLWGIAAIRSVVDIMISLLTQPISFF 171

  Fly   226 --FGWKDPDYM--KRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRAQ 286
              |....|.||  .:..:.|...||.:        |...| .::|.:.|.::...|||.:.:.:.
Zfish   172 RSFVPCYPTYMFPSKAHDDHNTASQVI--------CMSMV-WIIICYTYCRVLFAARKAVSKGSA 227

  Fly   287 KSFNVTL 293
            .....|:
Zfish   228 SKARSTI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT1BNP_001137708.2 7tm_1 107..>288 CDD:278431 39/201 (19%)
or90h4NP_001129719.1 7tm_4 32..>161 CDD:304433 25/134 (19%)
7tm_1 42..288 CDD:278431 40/208 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.