DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT1B and or90h3

DIOPT Version :9

Sequence 1:NP_001137708.2 Gene:5-HT1B / 37191 FlyBaseID:FBgn0263116 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_009300995.1 Gene:or90h3 / 103911276 ZFINID:ZDB-GENE-081104-20 Length:309 Species:Danio rerio


Alignment Length:250 Identity:50/250 - (20%)
Similarity:101/250 - (40%) Gaps:50/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NTFDLVDDEQERAAVEFWLLVKMIAMAVVLGLMILVTIIGNVFVIAAI---ILERNLQNVANYLV 129
            ||...:.|..|.|      |.|.|   |::.|..::.:|..:.|:...   :..|:.:.:   |.
Zfish     2 NTTVWIVDSYEEA------LAKNI---VIVSLGFIINVINGMLVLTFFSNPMFSRDSRYI---LY 54

  Fly   130 ASLAVADLFVACLVMPLGAVYEISNGW-ILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVT 193
            ..|.:.|:.:.|:.:.|   |.::... ::...||.|......:....:.|:|..:|.:|:..:.
Zfish    55 IHLVINDMLMICVSVIL---YVLTYAAPVVNVSLCYILMILGKVFFMITPLNLAGMAIERFIAIC 116

  Fly   194 N-IDYNNLRTPRRVFLMIFCVW-------FAALIVSLAPQ-------FGWKDPDYM--KRIEEQH 241
            . :.::.:.||:|.:..|..:|       ...:|:||..|       |.:..|.||  .:..:.|
Zfish   117 KPLYHSQICTPQRTYFFICFLWCLGAISSMVNIIISLVTQPLSFFRSFIFCYPTYMFPSKAHDDH 181

  Fly   242 CMVSQDVGYQIFATCCTFYVPL--LVILFLYWKIYIIARKRIQR-RAQKSFNVTL 293
                       :......|:.:  ::|.:.|.::...|||.:.: .|.|:.|..|
Zfish   182 -----------YTASLVIYMSVVWIIICYTYCRVIFTARKAVSKGSANKARNTIL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT1BNP_001137708.2 7tm_1 107..>288 CDD:278431 36/204 (18%)
or90h3XP_009300995.1 7tm_4 19..>143 CDD:304433 24/132 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.