DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT1B and or90d1

DIOPT Version :9

Sequence 1:NP_001137708.2 Gene:5-HT1B / 37191 FlyBaseID:FBgn0263116 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_017212233.1 Gene:or90d1 / 100151233 ZFINID:ZDB-GENE-081104-36 Length:308 Species:Danio rerio


Alignment Length:258 Identity:52/258 - (20%)
Similarity:102/258 - (39%) Gaps:64/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NTFDLVDDEQERAAVEFWLLVKMIAMAVVLGLMILVTIIGNVFVIAAIILERNL--QNVANYLVA 130
            |:..|:..:|||.|..|......:.:||     |:::|.| :||.  |...|::  .:....|..
Zfish     2 NSTVLLYSQQERYADAFAKNFSTVLLAV-----IIISING-MFVF--IFFRRSIFHSDPRYILYI 58

  Fly   131 SLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILH------LVAIAADRY 189
            .|.:.|:.:..:.:.|   :.|:..|...|.     ..|.:|....|:.|      |..:|.:||
Zfish    59 HLVMNDMLMVFISVVL---FVITFAWHNVPV-----PFCVLLLLITSVSHRNTPLTLAGMAVERY 115

  Fly   190 WTVTN-IDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQHCMVSQDVGYQIF 253
            ..|.. :.::.:.|.|..:::|..:|...::..||..|                ::..:..:.:|
Zfish   116 IAVCKPLHHHQICTVRWTYVLISLIWSVGILPGLADFF----------------LLLINGPFALF 164

  Fly   254 ATCCT-------------------FY--VPLLVILFLYWKIYIIARKRIQRR--AQKSFNVTL 293
            .|.||                   .|  |..|::::.|.::.:.|::....:  |:|:.|..|
Zfish   165 ITICTPVTLYNTPSHAELSKIMNGIYSSVVWLILVYTYCQVMVKAKRSSTNKSSAKKTQNTIL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT1BNP_001137708.2 7tm_1 107..>288 CDD:278431 38/212 (18%)
or90d1XP_017212233.1 7tm_4 25..>147 CDD:304433 29/137 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.