Sequence 1: | NP_001137708.2 | Gene: | 5-HT1B / 37191 | FlyBaseID: | FBgn0263116 | Length: | 629 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001121859.1 | Gene: | or90b1 / 100148884 | ZFINID: | ZDB-GENE-070806-31 | Length: | 314 | Species: | Danio rerio |
Alignment Length: | 244 | Identity: | 45/244 - (18%) |
---|---|---|---|
Similarity: | 90/244 - (36%) | Gaps: | 62/244 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 NSNTF--DLVDDEQERAAVEFWLLVKMIAMAVVLGLMILVTIIGNVFVIAAIILERNLQNVANYL 128
Fly 129 VASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILH------LVAIAAD 187
Fly 188 RYWTVTN-IDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQHCMVSQDVGYQ 251
Fly 252 IFATCCT-------------------FY--VPLLVILFLYWKIYIIARK 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
5-HT1B | NP_001137708.2 | 7tm_1 | 107..>288 | CDD:278431 | 36/201 (18%) |
or90b1 | NP_001121859.1 | 7tm_1 | 38..273 | CDD:278431 | 38/211 (18%) |
7tm_4 | <107..>151 | CDD:304433 | 10/43 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24247 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |