DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5-HT1B and or92a1

DIOPT Version :9

Sequence 1:NP_001137708.2 Gene:5-HT1B / 37191 FlyBaseID:FBgn0263116 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_009293550.2 Gene:or92a1 / 100147882 ZFINID:ZDB-GENE-070806-47 Length:358 Species:Danio rerio


Alignment Length:243 Identity:49/243 - (20%)
Similarity:93/243 - (38%) Gaps:67/243 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 AMAVVLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGW 156
            |:||:..|.....   |..:|:.:..:|.......|::....:.:..|..||..:  :|.::   
Zfish    67 AVAVLTSLFFFSV---NCVMISVLKSKRMFYETPRYILFGHMLMNDSVLLLVTTV--MYTLA--- 123

  Fly   157 ILGPELCDI---WTSCDVLC----CT--ASILHLVAIAADRYWTVT-NIDYNNLRTPRRVFLMIF 211
                 ||.:   .:.|.:|.    ||  .:.|.|..::.:||..:. .:.:..:.||:|..:.|.
Zfish   124 -----LCFLPIHKSICTLLVLISYCTFFNAPLTLALMSLERYVAICFPLRHCTIATPKRTGIAIG 183

  Fly   212 CVWFAA-------LIVSLAPQFGWKDPDYMKRIEEQHC----------MVSQDVGYQIFATCCTF 259
            .:||.:       :|::|.     .:|.|:..|  ..|          .:.:..|:.:.     :
Zfish   184 IIWFLSSVNVVIDIIIALI-----NNPSYLAEI--AFCTLEKLFIAKWQIDKSQGFDVL-----Y 236

  Fly   260 YVPLLV-ILFLYWKIYIIARKRIQRRAQKSFNVTLTETDCDSAVRELK 306
            :|.:.| |:|.|..|.|.||.              ...|.:||.:.||
Zfish   237 FVSVAVTIIFTYIMIMITARS--------------VSADKESAKKALK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5-HT1BNP_001137708.2 7tm_1 107..>288 CDD:278431 40/208 (19%)
or92a1XP_009293550.2 7tm_classA_rhodopsin-like 68..332 CDD:320086 48/242 (20%)
TM helix 1 68..89 CDD:320086 5/23 (22%)
TM helix 2 98..122 CDD:320086 5/25 (20%)
TM helix 3 134..164 CDD:320086 8/29 (28%)
TM helix 4 177..196 CDD:320086 4/18 (22%)
TM helix 5 221..250 CDD:320086 6/33 (18%)
TM helix 6 263..296 CDD:320086 4/8 (50%)
TM helix 7 307..332 CDD:320086
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.