DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and ASR1

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_015418.2 Gene:ASR1 / 856208 SGDID:S000006297 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:57/293 - (19%)
Similarity:107/293 - (36%) Gaps:92/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CCVCL----DRYRIPKLLPCQHSFCMEPCMEGLVDYVRRQVKCPECRAE--HRIPYNGVQAFPTN 68
            |.:||    :..:...|..|.|.|.:. |:.....| ...:|||.||.|  |.....|..|...|
Yeast     4 CPICLADDQEGEQFGCLNVCGHKFHLN-CIREWHKY-SINLKCPICRVESTHLEVGEGQHALSIN 66

  Fly    69 VTLQRFLELHI-----EITGELPDPTSGQ----------------IME-----RCGVC--SEKAY 105
            :.:...::..|     |.|.|..:..:|:                :|:     :|.:|  ::.:.
Yeast    67 LKMGFMIKNAIDYVGAETTNERNEDDTGEQDQEIEFLSERLRGTLVMDTIKIIQCSICGDTDVSR 131

  Fly   106 LS-HCAHCEK--------------------KICEDCKS-----AHMDILRREITRFNSQIRRSL- 143
            || :|..||.                    :.|.||:|     ..|..:..::..::|  |.|: 
Yeast   132 LSLYCQDCEAIYHETCLRGLACEVGDRNTWQECTDCRSNALLELRMGAISSQLASYDS--RNSMI 194

  Fly   144 --HRLQDSLAIIEKNTMSLQTNAISVTEEIDEIYQRITKAIKDRSDQLKGEIDRYLAVELRNLTT 206
              ..|:|      |:::..|           ::|::|..|.......::..:|||....||....
Yeast   195 FAGELRD------KHSVKTQ-----------QMYEQIRNAKHKIQMHVRRALDRYPLPLLRFKDA 242

  Fly   207 LK---ENLDLEITNITSNCDTVDKYMNETVEWD 236
            .|   :.:..::..::.|     ||:.:..::|
Yeast   243 YKHVNKQVSRKLYRLSDN-----KYLPDQYDYD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093 14/47 (30%)
zf-B_box 94..>122 CDD:279037 11/55 (20%)
iSH2_PI3K_IA_R 131..231 CDD:304922 19/105 (18%)
NHL_TRIM71_like 1234..1517 CDD:271324
YncE 1253..>1517 CDD:225926
NHL repeat 1258..1297 CDD:271324
WD40 repeat 1261..1304 CDD:293791
NHL repeat 1305..1344 CDD:271324
WD40 repeat 1345..1377 CDD:293791
NHL repeat 1352..1388 CDD:271324
NHL repeat 1396..1436 CDD:271324
WD40 repeat 1402..1439 CDD:293791
NHL repeat 1445..1475 CDD:271324
WD40 repeat 1446..1485 CDD:293791
NHL repeat 1491..1517 CDD:271324
ASR1NP_015418.2 RING-H2 4..48 CDD:319362 12/45 (27%)
PHD 121..167 CDD:214584 8/45 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1793
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.