DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and TRIM56

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_112223.1 Gene:TRIM56 / 81844 HGNCID:19028 Length:755 Species:Homo sapiens


Alignment Length:497 Identity:101/497 - (20%)
Similarity:169/497 - (34%) Gaps:156/497 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTCCVCLDRYRIPKLLPCQHSFCMEPCMEGLVDYVRRQVKCPECRAEHRIPYNGVQAFPTNVTLQ 72
            |.|.:||::.|.||.|||.|::|.: |:..|.|..|  |:|||||....:|..||.:|.||..:.
Human    19 LACKICLEQLRAPKTLPCLHTYCQD-CLAQLADGGR--VRCPECRETVPVPPEGVASFKTNFFVN 80

  Fly    73 RFLEL-HIEITGEL--------------PDPTSGQIMERCGVCSE-------------------- 102
            ..|:| .....|:|              ...|.|....||..|::                    
Human    81 GLLDLVKARACGDLRAGKPACALCPLVGGTSTGGPATARCLDCADDLCQACADGHRCTRQTHTHR 145

  Fly   103 -----------------------------KAYLSHCAHCEKKICEDCK-SAHMDILRREITRFNS 137
                                         :|....|..|.:.:|.:|: ..|:|   ........
Human   146 VVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFLCQPCSQLLCRECRLDPHLD---HPCLPLAE 207

  Fly   138 QIRRSLHRLQDSLAIIEKNTMSLQTNAISVTEEIDEIYQRITK----AIKDRSDQLKGEIDRYLA 198
            .:|.....|:..||.::.|.:.|            |..:|:.|    .:::::.::..:::....
Human   208 AVRARRPGLEGLLAGVDNNLVEL------------EAARRVEKEALARLREQAARVGTQVEEAAE 260

  Fly   199 VELRNLTTLKENLDLEITNITSNCDTVDKYMNETVEWDDCELMDTKEIFLKTVEFLRHFEYENND 263
            ..||.|...|:.:   :..:.::.:..::...|.:    .||...:::......|          
Human   261 GVLRALLAQKQEV---LGQLRAHVEAAEEAARERL----AELEGREQVARAAAAF---------- 308

  Fly   264 YSRRVRFL------VSIDPNQLVMNLATFGDLNIAPHSTPSGGSVSSSHLAPPSALQPGLMRSKS 322
             :|||..|      :|:: ..:...|........||...|.        |.|...|.|||: .|:
Human   309 -ARRVLSLGREAEILSLE-GAIAQRLRQLQGCPWAPGPAPC--------LLPQLELHPGLL-DKN 362

  Fly   323 DHRLATQF-RQQEERSGYNDEPVLGGRKFGERPQ-RSATQANNDRYG------------------ 367
            .|.|...| .||.::.|..|.   .|.:.||..| |...:...:|.|                  
Human   363 CHLLRLSFEEQQPQKDGGKDG---AGTQGGEESQSRREDEPKTERQGGVQPQAGDGAQTPKEEKA 424

  Fly   368 ---RSGGDYDYEND-----YDNEG----SSGRAGKSSRFRSR 397
               |..|....|.|     :::.|    ..||..|..:|:.|
Human   425 QTTREEGAQTLEEDRAQTPHEDGGPQPHRGGRPNKKKKFKGR 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093 21/44 (48%)
zf-B_box 94..>122 CDD:279037 8/77 (10%)
iSH2_PI3K_IA_R 131..231 CDD:304922 13/103 (13%)
NHL_TRIM71_like 1234..1517 CDD:271324
YncE 1253..>1517 CDD:225926
NHL repeat 1258..1297 CDD:271324
WD40 repeat 1261..1304 CDD:293791
NHL repeat 1305..1344 CDD:271324
WD40 repeat 1345..1377 CDD:293791
NHL repeat 1352..1388 CDD:271324
NHL repeat 1396..1436 CDD:271324
WD40 repeat 1402..1439 CDD:293791
NHL repeat 1445..1475 CDD:271324
WD40 repeat 1446..1485 CDD:293791
NHL repeat 1491..1517 CDD:271324
TRIM56NP_112223.1 RAD18 8..>214 CDD:333230 45/200 (23%)
RING-HC_TRIM56_C-V 19..60 CDD:319498 20/43 (47%)
RING-HC finger (C3HC4-type) 21..59 CDD:319498 18/40 (45%)
BBOX 169..205 CDD:237988 7/38 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..484 21/99 (21%)
NHL 521..748 CDD:302697
WD40 repeat 593..627 CDD:293791
NHL repeat 598..626 CDD:271320
NHL repeat 634..674 CDD:271320
WD40 repeat 635..672 CDD:293791
WD40 repeat 681..720 CDD:293791
NHL repeat 681..714 CDD:271320
NHL repeat 723..748 CDD:271320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.