DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and TRIM25

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_005073.2 Gene:TRIM25 / 7706 HGNCID:12932 Length:630 Species:Homo sapiens


Alignment Length:429 Identity:85/429 - (19%)
Similarity:146/429 - (34%) Gaps:135/429 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTCCVCLDRYRIPKLLPCQHSFCMEPCMEGLVDYVRRQVKCPECRAEHRIPYNGVQAFP---TNV 69
            |:|.:||:.::.|...||.|:|| ..|:............||:|||.:       ||.|   .|.
Human    11 LSCSICLEPFKEPVTTPCGHNFC-GSCLNETWAVQGSPYLCPQCRAVY-------QARPQLHKNT 67

  Fly    70 TLQRFLE--LHIEITGELP----------DPTSGQIMERCGVCSEKAYLSHCAHCEKKICEDCKS 122
            .|...:|  |..::..|.|          ...|......|..|.::|.:..|..|....|::...
Human    68 VLCNVVEQFLQADLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCLVCMASFCQEHLQ 132

  Fly   123 AHM---------------DILRREITRFNSQIRRSLHRLQD-----------SLAIIEKNTMS-- 159
            .|.               |:|||:.::.|        ||::           .:.::|..|.|  
Human   133 PHFDSPAFQDHPLQPPVRDLLRRKCSQHN--------RLREFFCPEHSECICHICLVEHKTCSPA 189

  Fly   160 --LQTNA---ISVTEEIDEIYQRITKA------IKDRSDQLKGEIDRYLAVELRNLTTLKENLDL 213
              .|.:|   .::..::..:|.:|..|      :::|...::...:|.:....:..|.:|..||.
Human   190 SLSQASADLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQLQQEYTEMKALLDA 254

  Fly   214 EITNITSNCDTVDKYMN---------------------ETVEW-----DDCELMD---------T 243
            ..|..|......:|.:|                     |.:|.     |:.|.::         |
Human   255 SETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLTKRDEFEFLEKASKLRGIST 319

  Fly   244 KEIFLKTVEFLRHFEYENNDYSRRVRFLVSID-PNQLVMNLATFGDLNIAPHSTPSGGSVSSSHL 307
            |.:::..|| |.|...:....|       :|| .|:|...:....:      .|||.|       
Human   320 KPVYIPEVE-LNHKLIKGIHQS-------TIDLKNELKQCIGRLQE------PTPSSG------- 363

  Fly   308 APPSALQPGLMRSKSDHRLATQFRQ--QEERSGYNDEPV 344
                  .||.....|.|:.....::  :||:......||
Human   364 ------DPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093 14/44 (32%)
zf-B_box 94..>122 CDD:279037 6/27 (22%)
iSH2_PI3K_IA_R 131..231 CDD:304922 21/144 (15%)
NHL_TRIM71_like 1234..1517 CDD:271324
YncE 1253..>1517 CDD:225926
NHL repeat 1258..1297 CDD:271324
WD40 repeat 1261..1304 CDD:293791
NHL repeat 1305..1344 CDD:271324
WD40 repeat 1345..1377 CDD:293791
NHL repeat 1352..1388 CDD:271324
NHL repeat 1396..1436 CDD:271324
WD40 repeat 1402..1439 CDD:293791
NHL repeat 1445..1475 CDD:271324
WD40 repeat 1446..1485 CDD:293791
NHL repeat 1491..1517 CDD:271324
TRIM25NP_005073.2 RING 13..53 CDD:302633 12/40 (30%)
Interaction with influenza A virus NS1 180..450 45/244 (18%)
HR1 180..252 CDD:294066 12/71 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..403 12/61 (20%)
SPRY_PRY_TRIM25 459..627 CDD:293971
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2677
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.