DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and RNF208

DIOPT Version :10

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_112587.2 Gene:RNF208 / 727800 HGNCID:25420 Length:261 Species:Homo sapiens


Alignment Length:131 Identity:34/131 - (25%)
Similarity:49/131 - (37%) Gaps:40/131 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTCCVCLDRYRI----PKLLPCQHSFCMEPCMEGLVDYVRRQ--VKCPECRAEHRI--PYNGVQA 64
            |.|..|...|.:    |::|.|.||.| |.|::.|.:...:.  :.||.||.|..:  .| |:.|
Human   141 LECPTCGHSYNVTQRRPRVLSCLHSVC-EQCLQILYESCPKYKFISCPTCRRETVLFTDY-GLAA 203

  Fly    65 FPTNVTLQRFLELHIEITGELPD-----PTSGQ------------IMERCG---VCSEKAYLSHC 109
            ...|.:          |...||.     |:.||            ..:.||   .|..:..||.|
Human   204 LAVNTS----------ILSRLPPEALTAPSGGQWGAEPEGSCYQTFRQYCGAACTCHVRNPLSAC 258

  Fly   110 A 110
            :
Human   259 S 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING-HC_NHL-1-like 3..55 CDD:438187 17/52 (33%)
CC_brat-like 124..232 CDD:475168
NHL_TRIM71_like 1234..1517 CDD:271324
NHL repeat 1258..1297 CDD:271324
WD40 repeat 1261..1304 CDD:293791
NHL repeat 1305..1344 CDD:271324
WD40 repeat 1345..1377 CDD:293791
NHL repeat 1352..1388 CDD:271324
NHL repeat 1396..1436 CDD:271324
WD40 repeat 1402..1439 CDD:293791
NHL repeat 1445..1475 CDD:271324
WD40 repeat 1446..1485 CDD:293791
NHL repeat 1491..1517 CDD:271324
RNF208NP_112587.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..106
RING-HC_RNF208 140..195 CDD:438221 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.