DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and Trim71

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001035968.1 Gene:Trim71 / 636931 MGIID:2685973 Length:855 Species:Mus musculus


Alignment Length:310 Identity:122/310 - (39%)
Similarity:176/310 - (56%) Gaps:15/310 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1208 SPTSPTVAAAVAAAGITGAAGTIPKQVYLRKRQQLFQLGGRGSEPGSFTWPRGLAVGPDNSIVVA 1272
            ||....|.:..:..|| |..|              ...|..|...|....|.|::|..:..|:||
Mouse   561 SPFKVVVKSGRSYVGI-GLPG--------------LSFGSEGDGEGKLCRPWGVSVDKEGFIIVA 610

  Fly  1273 DSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLR 1337
            |.||:|:|||...|.|..:||..|:..|:||..||||.:...:.|:||:.|||||:...:|:||.
Mouse   611 DRSNNRIQVFKPCGSFHHKFGTLGSRPGQFDRPAGVACDASRRIIVADKDNHRIQIFTFEGQFLL 675

  Fly  1338 AFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYI 1402
            .||.:||.:|:|||||.|..::.|.|.|.|..|||:|:|..||.|:.|:|..|......:.|..:
Mouse   676 KFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGSLWKHFDSPRGV 740

  Fly  1403 AVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRI 1467
            |.:|...::|:|.||||:.:...:.:....:|.|||.:|||..|:|||||.:|.|.||||.|:|:
Mouse   741 AFNNEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGSGNGQFLRPQGVAVDQEGRIIVADSRNHRV 805

  Fly  1468 QIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGNILVCDRENHRVQVF 1517
            |:|..:||||..||:.|||..:.....|:|:..:|.|:|.|..|:|:.:|
Mouse   806 QMFEANGSFLCKFGAQGSGFGQMDRPSGIAVTPDGLIVVVDFGNNRILIF 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093
zf-B_box 94..>122 CDD:279037
iSH2_PI3K_IA_R 131..231 CDD:304922
NHL_TRIM71_like 1234..1517 CDD:271324 114/282 (40%)
YncE 1253..>1517 CDD:225926 112/263 (43%)
NHL repeat 1258..1297 CDD:271324 17/38 (45%)
WD40 repeat 1261..1304 CDD:293791 18/42 (43%)
NHL repeat 1305..1344 CDD:271324 17/38 (45%)
WD40 repeat 1345..1377 CDD:293791 15/31 (48%)
NHL repeat 1352..1388 CDD:271324 16/35 (46%)
NHL repeat 1396..1436 CDD:271324 10/39 (26%)
WD40 repeat 1402..1439 CDD:293791 11/36 (31%)
NHL repeat 1445..1475 CDD:271324 16/29 (55%)
WD40 repeat 1446..1485 CDD:293791 22/38 (58%)
NHL repeat 1491..1517 CDD:271324 8/25 (32%)
Trim71NP_001035968.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..177
zf-B_box 186..217 CDD:279037
zf-B_box 265..298 CDD:279037
iSH2_PI3K_IA_R 301..431 CDD:304922
Filamin 466..567 2/5 (40%)
Filamin 469..564 CDD:279024 2/2 (100%)
IG_FLMN 471..568 CDD:214720 2/6 (33%)
NHL_TRIM71_like 571..855 CDD:271324 118/298 (40%)
NHL 1 580..623 17/56 (30%)
NHL repeat 596..635 CDD:271324 17/38 (45%)
NHL 2 627..670 18/42 (43%)
NHL repeat 643..682 CDD:271324 17/38 (45%)
NHL 3 674..717 21/42 (50%)
NHL repeat 690..726 CDD:271324 16/35 (46%)
WD40 repeat 691..727 CDD:293791 16/35 (46%)
NHL 4 721..764 12/42 (29%)
NHL repeat 734..774 CDD:271324 10/39 (26%)
WD40 repeat 737..774 CDD:293791 10/36 (28%)
NHL 5 768..811 23/42 (55%)
WD40 repeat 782..821 CDD:293791 22/38 (58%)
NHL repeat 783..813 CDD:271324 16/29 (55%)
NHL 6 815..855 14/39 (36%)
NHL repeat 829..855 CDD:271324 8/25 (32%)
WD40 repeat 831..855 CDD:293791 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA7J
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133242at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43444
orthoMCL 1 0.900 - - OOG6_105050
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.