DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and trim32

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001107066.1 Gene:trim32 / 562764 ZFINID:ZDB-GENE-060428-1 Length:663 Species:Danio rerio


Alignment Length:399 Identity:92/399 - (23%)
Similarity:151/399 - (37%) Gaps:93/399 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1179 SRRLSLG-LPLRQANELASSDDDGSKNGLGSPTS--------------PTVAAAVAAA------- 1221
            |:.|.:| |..:..|.....::|    ||..||:              |.|..||.|:       
Zfish   287 SKSLEVGQLTTKPCNVNVEEEED----GLDFPTATSAPLDIYRDIDMVPAVEEAVCASPGSFKSK 347

  Fly  1222 GITGAAGTIPKQVYLRKRQQLFQLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNG 1286
            .:.| .|..|.....:..|.:.::|.:|:.||.|..|..:.|.....::|||..|:|:|:|:..|
Zfish   348 SVDG-GGPSPGASGGQLCQFVKKMGCKGNLPGMFNLPVSICVTLQGEVLVADRGNYRIQIFNRKG 411

  Fly  1287 IFVKEFGEYGNGEGEFDCLA------------GVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAF 1339
             |.:|.....:....| .|:            .:|:...|...:.|.|::.::|....|..:...
Zfish   412 -FQREIRRNPSSIDNF-VLSFLGADLPNLIPLSIAITAQGLIGVTDNYDNSVKVYTTDGHCIACH 474

  Fly  1340 GSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVG-------------KFGSCGR 1391
            .:|      ...|||:.....|...|.|.|..::.....|.: ||             ||.:|. 
Zfish   475 KNQ------LIKPWGIAAMPSGQFVVSDVEGGKLWCLAVDRN-VGVVNYNRLCSAVRPKFVTCD- 531

  Fly  1392 GEGQLEHPHYIAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEG----------SDDGQFKFP 1446
            ..|.:.....:.::..||     .|.|.::    .|..:.:||.:|          |:...|:..
Zfish   532 SSGTVYFTQGLGLNIENR-----HNEHHLE----GGFSIGSVGMDGQLGKQLSHFFSETEDFRCI 587

  Fly  1447 RGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLE---GVAIMSNGNILVCD 1508
            .|:.||..|.:.|.|||...|..|..:|.:.....         :||.   |||:...|.:||.|
Zfish   588 TGMCVDSNGDLIVTDSGRKEILQFPKEGGYNILIQ---------EGLTCPVGVAVTQKGQLLVLD 643

  Fly  1509 RENHRVQVF 1517
            ..:|.|:|:
Zfish   644 CWDHCVKVY 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093
zf-B_box 94..>122 CDD:279037
iSH2_PI3K_IA_R 131..231 CDD:304922
NHL_TRIM71_like 1234..1517 CDD:271324 73/320 (23%)
YncE 1253..>1517 CDD:225926 69/301 (23%)
NHL repeat 1258..1297 CDD:271324 12/38 (32%)
WD40 repeat 1261..1304 CDD:293791 12/42 (29%)
NHL repeat 1305..1344 CDD:271324 8/50 (16%)
WD40 repeat 1345..1377 CDD:293791 7/31 (23%)
NHL repeat 1352..1388 CDD:271324 12/48 (25%)
NHL repeat 1396..1436 CDD:271324 7/39 (18%)
WD40 repeat 1402..1439 CDD:293791 8/46 (17%)
NHL repeat 1445..1475 CDD:271324 10/29 (34%)
WD40 repeat 1446..1485 CDD:293791 11/38 (29%)
NHL repeat 1491..1517 CDD:271324 11/28 (39%)
trim32NP_001107066.1 zf-RING_UBOX 18..60 CDD:290181
BBOX 96..136 CDD:197662
NHL_TRIM32_like 371..653 CDD:271331 73/310 (24%)
NHL repeat 383..423 CDD:271331 12/40 (30%)
NHL repeat 440..478 CDD:271331 7/43 (16%)
NHL repeat 481..521 CDD:271331 10/40 (25%)
NHL repeat 522..573 CDD:271331 12/60 (20%)
NHL repeat 586..618 CDD:271331 11/31 (35%)
NHL repeat 626..652 CDD:271331 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.