DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and trim71

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001288260.1 Gene:trim71 / 561754 ZFINID:ZDB-GENE-040128-1 Length:813 Species:Danio rerio


Alignment Length:405 Identity:138/405 - (34%)
Similarity:203/405 - (50%) Gaps:51/405 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1149 SSSAAASSSHAHGYG--SGTSGSSGRSTA----SDVSRRLSLG-----LPLRQANELASSDDDGS 1202
            ||.|.|::|.|||.|  ....|.....|.    .|...|||.|     :.:.....|:|::....
Zfish   424 SSGAFATASKAHGEGIKRALQGKPASFTVVGYDHDGEPRLSGGDSVSVVLMSPDGNLSSAEVSDH 488

  Fly  1203 KNGL-------------------------GSPTSPTVAAAVAAAGITGAAGTIPKQVYLRKRQQL 1242
            ::|.                         |||....|.:..:..|:     .:|          :
Zfish   489 QDGTYTVSYLPKGEGEHLLSVLICNQHIEGSPFKVMVKSGRSYGGV-----GLP----------M 538

  Fly  1243 FQLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAG 1307
            ...||.|...|....|.|:.|..:..:||||.||:|||:|...|.|..:||..|:..|:||..||
Zfish   539 ASFGGEGDGDGQLCRPWGICVDKEGYVVVADRSNNRVQIFKPCGTFHHKFGTLGSRPGQFDRPAG 603

  Fly  1308 VAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHR 1372
            ||.:...:.|:||:.|||||:....|:||..||.:||.:|:|||||.|..:..|.|.|.|..|||
Zfish   604 VACDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQFNYPWDVAVNFEGKILVSDTRNHR 668

  Fly  1373 VQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEG 1437
            ||:|..||:|:.|:|..|......:.|..:|.:....::|:|.||||:.:...:.:....:|.||
Zfish   669 VQLFGPDGTFLNKYGFEGALWKHFDSPRGVAFNQEGHLVVTDFNNHRLLVIRPDCQSARFLGSEG 733

  Fly  1438 SDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNG 1502
            :.:|||..|:|||||.:..|.||||.|:|||:|.|:|:||..||:.|:|..:.....|:|:..:|
Zfish   734 TGNGQFLRPQGVAVDQEDRIIVADSRNHRIQVFEPNGNFLCKFGTHGNGFGQMDRPSGIAVTPDG 798

  Fly  1503 NILVCDRENHRVQVF 1517
            .|:..|..|:|:.:|
Zfish   799 VIVAVDFGNNRILMF 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093
zf-B_box 94..>122 CDD:279037
iSH2_PI3K_IA_R 131..231 CDD:304922
NHL_TRIM71_like 1234..1517 CDD:271324 112/282 (40%)
YncE 1253..>1517 CDD:225926 109/263 (41%)
NHL repeat 1258..1297 CDD:271324 17/38 (45%)
WD40 repeat 1261..1304 CDD:293791 18/42 (43%)
NHL repeat 1305..1344 CDD:271324 17/38 (45%)
WD40 repeat 1345..1377 CDD:293791 16/31 (52%)
NHL repeat 1352..1388 CDD:271324 17/35 (49%)
NHL repeat 1396..1436 CDD:271324 9/39 (23%)
WD40 repeat 1402..1439 CDD:293791 10/36 (28%)
NHL repeat 1445..1475 CDD:271324 17/29 (59%)
WD40 repeat 1446..1485 CDD:293791 22/38 (58%)
NHL repeat 1491..1517 CDD:271324 7/25 (28%)
trim71NP_001288260.1 zf-B_box 141..172 CDD:279037
zf-B_box 219..257 CDD:279037
iSH2_PI3K_IA_R 259..389 CDD:304922
Filamin 427..522 CDD:279024 20/94 (21%)
IG_FLMN 429..526 CDD:214720 19/96 (20%)
NHL_TRIM71_like 529..813 CDD:271324 114/298 (38%)
YncE 554..>804 CDD:225926 105/249 (42%)
NHL repeat 554..593 CDD:271324 17/38 (45%)
NHL repeat 601..640 CDD:271324 17/38 (45%)
NHL repeat 648..684 CDD:271324 17/35 (49%)
NHL repeat 692..732 CDD:271324 9/39 (23%)
NHL repeat 741..771 CDD:271324 17/29 (59%)
NHL repeat 787..813 CDD:271324 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA7J
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133242at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25398
orthoMCL 1 0.900 - - OOG6_105050
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.