powered by:
Protein Alignment tn and rnf152
DIOPT Version :9
Sequence 1: | NP_001137707.1 |
Gene: | tn / 37190 |
FlyBaseID: | FBgn0265356 |
Length: | 1517 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001014380.2 |
Gene: | rnf152 / 541544 |
ZFINID: | ZDB-GENE-050327-84 |
Length: | 206 |
Species: | Danio rerio |
Alignment Length: | 54 |
Identity: | 20/54 - (37%) |
Similarity: | 32/54 - (59%) |
Gaps: | 5/54 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 LTCCVCLDRY---RIPKLLPCQHSFCMEPCMEGLVDYVRRQVKCPECRAEHRIP 58
|.|.:|.:.: |:||||.|||: |...|:..: ...:|:::||.||...:||
Zfish 19 LECQICFNYFSQRRLPKLLHCQHT-CCSVCLSQM-RLSQREIRCPWCRCVTQIP 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D489543at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.