DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tn and Rnf208

DIOPT Version :9

Sequence 1:	NP_001137707.1	Gene:	tn / 37190	FlyBaseID:	FBgn0265356	Length:	1517	Species:	Drosophila melanogaster
Sequence 2:	NP_001102665.1	Gene:	Rnf208 / 499748	RGDID:	1565957	Length:	265	Species:	Rattus norvegicus

Alignment Length:	131	Identity:	33/131 - (25%)
Similarity:	48/131 - (36%)	Gaps:	40/131 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly     8 LTCCVCLDRYRI----PKLLPCQHSFCMEPCMEGLVDYVRRQ--VKCPECRAEHRI--PYNGVQA 64
            |.|..|...|.:    |::|.|.||.| |.|::.|.:...:.  :.||.|..|..:  .| |:.|
  Rat   145 LECPTCGHTYNVTQRRPRVLSCLHSVC-EQCLQILYESCPKYKFISCPTCHRETVLFTDY-GLAA 207

  Fly    65 FPTNVTLQRFLELHIEITGELPD-----PTSGQ------------IMERCG---VCSEKAYLSHC 109
            ...|.:          |...||.     |:.||            ..:.||   .|..:..||.|
  Rat   208 LAVNTS----------ILSRLPPEALTAPSGGQWGGESEGSCYQTFRQYCGAACTCHVRNPLSAC 262

  Fly   110 A 110
            :
  Rat   263 S 263

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tn	NP_001137707.1	RING	9..54	CDD:238093	15/50 (30%)
		zf-B_box	94..>122	CDD:279037	6/20 (30%)
		iSH2_PI3K_IA_R	131..231	CDD:304922
		NHL_TRIM71_like	1234..1517	CDD:271324
		YncE	1253..>1517	CDD:225926
		NHL repeat	1258..1297	CDD:271324
		WD40 repeat	1261..1304	CDD:293791
		NHL repeat	1305..1344	CDD:271324
		WD40 repeat	1345..1377	CDD:293791
		NHL repeat	1352..1388	CDD:271324
		NHL repeat	1396..1436	CDD:271324
		WD40 repeat	1402..1439	CDD:293791
		NHL repeat	1445..1475	CDD:271324
		WD40 repeat	1446..1485	CDD:293791
		NHL repeat	1491..1517	CDD:271324
Rnf208	NP_001102665.1	RING-HC_RNF208	144..197	CDD:319473	16/52 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D489543at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.920