DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and NHLRC3

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001012772.1 Gene:NHLRC3 / 387921 HGNCID:33751 Length:347 Species:Homo sapiens


Alignment Length:358 Identity:90/358 - (25%)
Similarity:140/358 - (39%) Gaps:80/358 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1172 RSTASDVSRRLSLGLPLRQANELASSDDDGSKNGLGSPTSPT----VAAAVAAAGITGAAGTIPK 1232
            |...|.|.|..:..:..|....|...|       :|.|..|.    ....||...:.|       
Human    23 RFCGSPVLRNFTFAVSWRTEKILYRLD-------VGWPKHPEYFTGTTFCVAVDSLNG------- 73

  Fly  1233 QVYLRKRQQLFQLGGRG---------SEPGSF--TW------PRGLAVGP---DNSIVVADSSN- 1276
                     |..:|.||         :|.|.|  .|      |.|:....   :.|:.:.|..: 
Human    74 ---------LVYIGQRGDNIPKILVFTEDGYFLRAWNYTVDTPHGIFAASTLYEQSVWITDVGSG 129

  Fly  1277 ---HRVQVFDSNGIFVKEFGEYGNGEG------EFDCLAGVAVNRIGQYIIAD---RYNHRIQVL 1329
               |.|:.:.|.|..|:..|..|. :|      :||..|.:.|...|...|.|   ..|:|:..|
Human   130 FFGHTVKKYSSFGDLVQVLGTPGK-KGTSLNPLQFDNPAELYVEDTGDIYIVDGDGGLNNRLIKL 193

  Fly  1330 DPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSD-GSFVGKFGSCGRGE 1393
            ......|...|..||...|||.|..||.|:.|.::|.|:.|.|:|||..| |.::|.:.:|...|
Human   194 SQDFMILWLHGENGTGPAKFNIPHSVTLDSAGRVWVADRGNKRIQVFDKDTGEWLGAWNNCFTEE 258

  Fly  1394 GQLEHPHYIAVSNTNR-VIVSDSNNHRIQIFDV-------NGKVLSTVGGEGSDDGQFKFPRGVA 1450
            |    |..:..:...: :||:..|..|:.:...       ...|:||:  :.:|.   ..|..:.
Human   259 G----PSSVRFTPDGKYLIVAQLNLSRLSVVAAPPVGSIGECSVISTI--QLADQ---VLPHLLE 314

  Fly  1451 VDDQ-GYIFVADSGNNRIQIFNPDGSFLKTFGS 1482
            ||.: |.::||:.|..::|.:.|..|::.:|||
Human   315 VDRKTGAVYVAEIGAKQVQKYVPLNSYVPSFGS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093
zf-B_box 94..>122 CDD:279037
iSH2_PI3K_IA_R 131..231 CDD:304922
NHL_TRIM71_like 1234..1517 CDD:271324 77/292 (26%)
YncE 1253..>1517 CDD:225926 72/264 (27%)
NHL repeat 1258..1297 CDD:271324 10/45 (22%)
WD40 repeat 1261..1304 CDD:293791 11/55 (20%)
NHL repeat 1305..1344 CDD:271324 10/41 (24%)
WD40 repeat 1345..1377 CDD:293791 14/31 (45%)
NHL repeat 1352..1388 CDD:271324 15/36 (42%)
NHL repeat 1396..1436 CDD:271324 8/47 (17%)
WD40 repeat 1402..1439 CDD:293791 7/44 (16%)
NHL repeat 1445..1475 CDD:271324 9/30 (30%)
WD40 repeat 1446..1485 CDD:293791 13/38 (34%)
NHL repeat 1491..1517 CDD:271324
NHLRC3NP_001012772.1 NHL 1 47..93 11/68 (16%)
NHL 66..336 CDD:302697 75/295 (25%)
NHL repeat 107..153 CDD:271320 10/45 (22%)
NHL 2 150..196 12/46 (26%)
NHL repeat 166..205 CDD:271320 9/38 (24%)
NHL 3 200..243 19/42 (45%)
NHL repeat 213..250 CDD:271320 16/36 (44%)
NHL repeat 258..295 CDD:271320 7/40 (18%)
NHL 4 294..338 12/48 (25%)
NHL repeat 308..335 CDD:271320 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.