DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and Trim71

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001178730.1 Gene:Trim71 / 301042 RGDID:1566388 Length:855 Species:Rattus norvegicus


Alignment Length:276 Identity:112/276 - (40%)
Similarity:167/276 - (60%) Gaps:0/276 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1242 LFQLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLA 1306
            :...|..|...|....|.|::|..:..|:|||.||:|:|||...|.|..:||..|:..|:||..|
  Rat   580 VLSFGSEGDGEGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGSFHHKFGTLGSRPGQFDRPA 644

  Fly  1307 GVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENH 1371
            |||.:...:.::||:.|||||:...:|:||..||.:||.:|:|||||.|..::.|.|.|.|..||
  Rat   645 GVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNH 709

  Fly  1372 RVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGE 1436
            |:|:|..||.|:.|:|..|......:.|..:|.::...::|:|.||||:.:...:.:....:|.|
  Rat   710 RIQLFGPDGVFLNKYGFEGSLWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQSARFLGSE 774

  Fly  1437 GSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSN 1501
            |:.:|||..|:|||||.:|.|.||||.|:|:|:|..:||||..||:.|||..:.....|:|:...
  Rat   775 GTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFEANGSFLCKFGAQGSGFGQMDRPSGIAVTPE 839

  Fly  1502 GNILVCDRENHRVQVF 1517
            |.|:|.|..|:|:.:|
  Rat   840 GLIVVVDFGNNRILIF 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093
zf-B_box 94..>122 CDD:279037
iSH2_PI3K_IA_R 131..231 CDD:304922
NHL_TRIM71_like 1234..1517 CDD:271324 111/274 (41%)
YncE 1253..>1517 CDD:225926 109/263 (41%)
NHL repeat 1258..1297 CDD:271324 17/38 (45%)
WD40 repeat 1261..1304 CDD:293791 18/42 (43%)
NHL repeat 1305..1344 CDD:271324 16/38 (42%)
WD40 repeat 1345..1377 CDD:293791 15/31 (48%)
NHL repeat 1352..1388 CDD:271324 16/35 (46%)
NHL repeat 1396..1436 CDD:271324 9/39 (23%)
WD40 repeat 1402..1439 CDD:293791 10/36 (28%)
NHL repeat 1445..1475 CDD:271324 16/29 (55%)
WD40 repeat 1446..1485 CDD:293791 22/38 (58%)
NHL repeat 1491..1517 CDD:271324 8/25 (32%)
Trim71NP_001178730.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..48
RING <57..97 CDD:238093
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..177
zf-B_box 186..217 CDD:279037
zf-B_box 265..298 CDD:279037
iSH2_PI3K_IA_R 301..431 CDD:304922
Filamin 466..567
Filamin 469..564 CDD:279024
IG_FLMN 471..568 CDD:214720
NHL_TRIM71_like 571..855 CDD:271324 111/274 (41%)
NHL 1 580..623 16/42 (38%)
NHL repeat 596..635 CDD:271324 17/38 (45%)
NHL 2 627..670 17/42 (40%)
NHL repeat 643..682 CDD:271324 16/38 (42%)
NHL 3 674..717 21/42 (50%)
NHL repeat 690..726 CDD:271324 16/35 (46%)
WD40 repeat 691..727 CDD:293791 16/35 (46%)
NHL 4 721..764 11/42 (26%)
NHL repeat 734..774 CDD:271324 9/39 (23%)
NHL 5 768..811 22/42 (52%)
WD40 repeat 782..821 CDD:293791 22/38 (58%)
NHL repeat 783..813 CDD:271324 16/29 (55%)
NHL 6 815..855 14/39 (36%)
NHL repeat 829..855 CDD:271324 8/25 (32%)
WD40 repeat 831..855 CDD:293791 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA7J
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133242at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45506
orthoMCL 1 0.900 - - OOG6_105050
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.