DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and Trim45

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001099923.1 Gene:Trim45 / 295323 RGDID:1309168 Length:579 Species:Rattus norvegicus


Alignment Length:471 Identity:90/471 - (19%)
Similarity:162/471 - (34%) Gaps:142/471 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CCVCLDRYRIPKLLPCQHSFCMEPCMEGL-----VDY---------------------VRRQ--V 46
            |..||..:::|:||||.|:.|.. |:|.|     ||.                     ::.|  :
  Rat    29 CPSCLRLFKVPRLLPCLHTVCTS-CLERLDPFSVVDIRGGDSDTSSEGSIFQEPKSCSLKPQIGI 92

  Fly    47 KCPECRAEHRIPYNGVQAFP------TNVTLQRFLELHIEITGELPDPTSG-QIMERCGVCSEKA 104
            .||.|.|:..:|..||:|..      .:|.|:   .||.|..|.:.|..|. ::.:||..|  ||
  Rat    93 LCPVCDAQVDLPLGGVKALTVDHLAMNDVMLE---SLHGEGQGLVCDLCSDREVEKRCQTC--KA 152

  Fly   105 YLSH----------------------------------------------CAHCEKKICEDC--- 120
            .|.|                                              |..|::.:|.||   
  Rat   153 NLCHFCCQAHRRQKKTTDHTMVDLKDLKGYSRVGKPILCPSHPAEELRLFCELCDRPVCRDCVVG 217

  Fly   121 --KSAHMDILRREITRFNSQIRRSL-------HRLQDSLAIIEKNTMSLQTNAISVTEEIDEIYQ 176
              :....|.....|.:....:|..|       ..|:|:||.|:.:..:||....:|..::....:
  Rat   218 EHREHPYDFTSNVIHKHGDSVRELLRDTQPHVEALEDALAQIKSSNNALQERVEAVAADVRTFSE 282

  Fly   177 RITKAIKDRSDQLKGEIDRYLAVELRNLTTLKENLDLEITNITSNCDTVDKYMNETVEWDDCELM 241
            ...:||::..|:|..::|.....:..:|...|..|:..:.::.:..:..:..:   ....|.|::
  Rat   283 GYIRAIEEHRDKLLRQLDDIRVQKENSLQLQKAQLEQLLADMRTGVEFTEHLL---TSGSDLEIL 344

  Fly   242 DTKEIFLKTVEFLRHFEYENNDYSRR--VRFLVSIDPNQLVMNLATFGDLNIAPHSTPSG----G 300
            .||.:.::.:..|...|     ||.|  |...:...|.:               .:...|    |
  Rat   345 VTKGVVVERLRKLNKVE-----YSARPGVNHKICFSPQE---------------KARCQGYEVYG 389

  Fly   301 SVSSSHLAPPSALQPGLMRSKSDHRLATQFR--------QQEERSGYNDEPVLGGRKFGERPQRS 357
            ::::..:.|...:..|....::..:....|.        :...|.|.|....:..:...:.|.|:
  Rat   390 AINTQEVDPAQCVLQGEDLHRAREKQTASFTLVCKDATGESMSRGGDNVRVEVVPKNKKDSPIRT 454

  Fly   358 ATQANNDRYGRSGGDY 373
            ..|.|.|      |.|
  Rat   455 VVQDNKD------GSY 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093 19/71 (27%)
zf-B_box 94..>122 CDD:279037 12/78 (15%)
iSH2_PI3K_IA_R 131..231 CDD:304922 19/106 (18%)
NHL_TRIM71_like 1234..1517 CDD:271324
YncE 1253..>1517 CDD:225926
NHL repeat 1258..1297 CDD:271324
WD40 repeat 1261..1304 CDD:293791
NHL repeat 1305..1344 CDD:271324
WD40 repeat 1345..1377 CDD:293791
NHL repeat 1352..1388 CDD:271324
NHL repeat 1396..1436 CDD:271324
WD40 repeat 1402..1439 CDD:293791
NHL repeat 1445..1475 CDD:271324
WD40 repeat 1446..1485 CDD:293791
NHL repeat 1491..1517 CDD:271324
Trim45NP_001099923.1 BBOX 189..226 CDD:237988 5/36 (14%)
iSH2_PI3K_IA_R 237..357 CDD:304922 22/122 (18%)
Filamin 396..492 CDD:279024 13/75 (17%)
IG_FLMN 398..496 CDD:214720 13/73 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.