DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and TRIM2

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001362417.1 Gene:TRIM2 / 23321 HGNCID:15974 Length:802 Species:Homo sapiens


Alignment Length:431 Identity:139/431 - (32%)
Similarity:207/431 - (48%) Gaps:56/431 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1104 TTDSKDGEALSSWARYLKNKYGNKSSKDSAGSSGSARDTHAGSSTSSSAAASSSHAHGYGSGTSG 1168
            ||..||||...:...||.   ...|:.|.:.:.|...|...|           ::...|.....|
Human   407 TTKDKDGELCKTGNAYLT---AELSTPDGSVADGEILDNKNG-----------TYEFLYTVQKEG 457

  Fly  1169 SSGRSTASDVSRRLSL------GLPLRQANELASSDDDGSKNGLGSPTSPTVAAAVAAAG---IT 1224
                    |.:..|.|      |.|.: ...:.|:|        .|||:..|...|.:.|   :.
Human   458 --------DFTLSLRLYDQHIRGSPFK-LKVIRSAD--------VSPTTEGVKRRVKSPGSGHVK 505

  Fly  1225 GAAGTIPKQVY-LRKRQQ-------LFQLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQV 1281
            ..|...|..:| ..||::       :|::|.:|...|.||..:|:|...:..|::|||:|..||:
Human   506 QKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQI 570

  Fly  1282 FDSNGIFVKEFGEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTAD 1346
            |.::|.|...||..|...|:.....||||:..|..||||..|..:.:....|:|....||     
Human   571 FSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGS----- 630

  Fly  1347 GKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAVSNTNRVI 1411
            ||...|.||:.|..|.|.|.|.:...|.:||.:|..|.:|||.|.|:.|...||:.||::.|.:|
Human   631 GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEII 695

  Fly  1412 VSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSF 1476
            ::|.:||.:::|:..|:.:...|..|..:|||..|.|||||..|.|.|||.||:|||:|:..|||
Human   696 ITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSF 760

  Fly  1477 LKTFGSWGSGDSEFKGLEGVAIMSNGNILVCDRENHRVQVF 1517
            |....:  |.|..: |.:|:|:.|:|:::|.|..||..:|:
Human   761 LSYINT--SADPLY-GPQGLALTSDGHVVVADSGNHCFKVY 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093
zf-B_box 94..>122 CDD:279037
iSH2_PI3K_IA_R 131..231 CDD:304922
NHL_TRIM71_like 1234..1517 CDD:271324 108/290 (37%)
YncE 1253..>1517 CDD:225926 102/263 (39%)
NHL repeat 1258..1297 CDD:271324 14/38 (37%)
WD40 repeat 1261..1304 CDD:293791 15/42 (36%)
NHL repeat 1305..1344 CDD:271324 14/38 (37%)
WD40 repeat 1345..1377 CDD:293791 11/31 (35%)
NHL repeat 1352..1388 CDD:271324 14/35 (40%)
NHL repeat 1396..1436 CDD:271324 12/39 (31%)
WD40 repeat 1402..1439 CDD:293791 11/36 (31%)
NHL repeat 1445..1475 CDD:271324 17/29 (59%)
WD40 repeat 1446..1485 CDD:293791 21/38 (55%)
NHL repeat 1491..1517 CDD:271324 9/25 (36%)
TRIM2NP_001362417.1 RAD18 33..>136 CDD:227719
RING-HC_TRIM2 47..92 CDD:319681
Bbox_SF 142..214 CDD:381767
BBC 219..345 CDD:128778
IG_FLMN 383..479 CDD:214720 20/94 (21%)
NHL_TRIM2_like 529..802 CDD:271330 106/278 (38%)
NHL repeat 547..586 CDD:271330 14/38 (37%)
NHL repeat 594..633 CDD:271330 15/43 (35%)
NHL repeat 636..672 CDD:271330 14/35 (40%)
NHL repeat 680..720 CDD:271330 12/39 (31%)
NHL repeat 729..769 CDD:271330 22/41 (54%)
NHL repeat 772..798 CDD:271330 9/26 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 281 1.000 Inparanoid score I2896
Isobase 1 0.950 - 0 Normalized mean entropy S1793
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133242at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41389
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24104
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2677
SonicParanoid 1 1.000 - - X1654
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.