DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and TRIM32

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001093149.1 Gene:TRIM32 / 22954 HGNCID:16380 Length:653 Species:Homo sapiens


Alignment Length:575 Identity:131/575 - (22%)
Similarity:207/575 - (36%) Gaps:158/575 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   998 GTGDDSDSRYGTGRSRYLAMKERRTR--LARSRSSHQFGNDDEDLDEPVSPTTVSPSAYL----- 1055
            |...|..:||......| ..:|||.:  |||||   :|........|..:...|...:||     
Human   172 GVSKDLQARYKAVLQEY-GHEERRVQDELARSR---KFFTGSLAEVEKSNSQVVEEQSYLLNIAE 232

  Fly  1056 ---ASRCAYSGYGSSDLSRSRSSHALKSRDNSPITDRGAGSSRSSGLGGSSTTDSKDGEALSSWA 1117
               .|||.|.      |::      :|..|.:.:.:               |.|.::.|..:|..
Human   233 VQAVSRCDYF------LAK------IKQADVALLEE---------------TADEEEPELTASLP 270

  Fly  1118 RYLK------NKYGNKSSKDSAGSSGSARDTHAGSSTSSSAAASSSHAHGYGSGTSGSSGRSTAS 1176
            |.|.      .|.|:........:....|..:...|.:..|.||:                ::.|
Human   271 RELTLQDVELLKVGHVGPLQIGQAVKKPRTVNVEDSWAMEATASA----------------ASTS 319

  Fly  1177 DVSRRLSLGLPLRQANELASSDDDGSKNGLGSPTSPTVAAAVAAAGITG--AAGTIPKQVYLRKR 1239
            ...|.:.:                       ||.....:...:.|...|  ||..|.:.::|:| 
Human   320 VTFREMDM-----------------------SPEEVVASPRASPAKQRGPEAASNIQQCLFLKK- 360

  Fly  1240 QQLFQLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDC 1304
                 :|.:||.||.|..|..|.|.....::|||..|:|:|||...| |:||.....:|...| .
Human   361 -----MGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKG-FLKEIRRSPSGIDSF-V 418

  Fly  1305 LA------------GVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTT 1357
            |:            .||:|..|...:.|.|::.::|....|..:....||      .:.|||:|.
Human   419 LSFLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQ------LSKPWGITA 477

  Fly  1358 DALGFIYVCDKENHRVQVFQSD-GSFV-----------GKFGSCGRGEGQLEHPHYIAVSNTNRV 1410
            ...|...|.|.|..::..|..| ||.|           .||.:|. .||.:.....:.::..|| 
Human   478 LPSGQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCD-AEGTVYFTQGLGLNLENR- 540

  Fly  1411 IVSDSNNHRIQIFDVNGKVLSTVGGEG----------SDDGQFKFPRGVAVDDQGYIFVADSGNN 1465
                .|.|.::    .|..:.:||.:|          |::..|:...|:.||.:|.:.||||...
Human   541 ----QNEHHLE----GGFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRK 597

  Fly  1466 RIQIFNPDGSFLKTFGSWGSGDSEFKGLE---GVAIMSNGNILVCDRENHRVQVF 1517
            .|..|...|.:.....         :||.   |:|:...|.:||.|..:|.::::
Human   598 EILHFPKGGGYSVLIR---------EGLTCPVGIALTPKGQLLVLDCWDHCIKIY 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093
zf-B_box 94..>122 CDD:279037
iSH2_PI3K_IA_R 131..231 CDD:304922
NHL_TRIM71_like 1234..1517 CDD:271324 84/319 (26%)
YncE 1253..>1517 CDD:225926 78/300 (26%)
NHL repeat 1258..1297 CDD:271324 15/38 (39%)
WD40 repeat 1261..1304 CDD:293791 16/42 (38%)
NHL repeat 1305..1344 CDD:271324 11/50 (22%)
WD40 repeat 1345..1377 CDD:293791 8/31 (26%)
NHL repeat 1352..1388 CDD:271324 15/47 (32%)
NHL repeat 1396..1436 CDD:271324 7/39 (18%)
WD40 repeat 1402..1439 CDD:293791 8/46 (17%)
NHL repeat 1445..1475 CDD:271324 10/29 (34%)
WD40 repeat 1446..1485 CDD:293791 11/38 (29%)
NHL repeat 1491..1517 CDD:271324 9/28 (32%)
TRIM32NP_001093149.1 RING-HC_TRIM32_C-VII 19..65 CDD:319501
Bbox1_TRIM32_C-VII 98..138 CDD:380864
FAM184 <143..224 CDD:406160 16/55 (29%)
NHL 1 358..401 19/48 (40%)
NHL_TRIM32_like 362..644 CDD:271331 82/309 (27%)
NHL 2 415..458 9/43 (21%)
NHL 3 459..499 12/45 (27%)
NHL 4 562..605 12/42 (29%)
NHL 5 606..646 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.