DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and RNF152

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_775828.1 Gene:RNF152 / 220441 HGNCID:26811 Length:203 Species:Homo sapiens


Alignment Length:114 Identity:30/114 - (26%)
Similarity:46/114 - (40%) Gaps:41/114 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQFEQ--LLTCCVCLDRY---RIPKLLPCQHSFCMEPCMEGLVDYVRRQVKCPECR-------- 52
            ||...|  ||.|.:|.:.|   |.||||.|:|: |...|::.: ...::.|:||.||        
Human     1 METLSQDSLLECQICFNYYSPRRRPKLLDCKHT-CCSVCLQQM-RTSQKDVRCPWCRGVTKLPPG 63

  Fly    53 ---------------------AEH-----RIPYNGVQAFPTNVTLQRFL 75
                                 :||     ::|.||....|..::.:|.|
Human    64 FSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERAL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093 17/76 (22%)
zf-B_box 94..>122 CDD:279037
iSH2_PI3K_IA_R 131..231 CDD:304922
NHL_TRIM71_like 1234..1517 CDD:271324
YncE 1253..>1517 CDD:225926
NHL repeat 1258..1297 CDD:271324
WD40 repeat 1261..1304 CDD:293791
NHL repeat 1305..1344 CDD:271324
WD40 repeat 1345..1377 CDD:293791
NHL repeat 1352..1388 CDD:271324
NHL repeat 1396..1436 CDD:271324
WD40 repeat 1402..1439 CDD:293791
NHL repeat 1445..1475 CDD:271324
WD40 repeat 1446..1485 CDD:293791
NHL repeat 1491..1517 CDD:271324
RNF152NP_775828.1 RING-HC_RNF152 11..55 CDD:319462 15/45 (33%)
Necessary for interaction with RRAGA. /evidence=ECO:0000269|PubMed:25936802 106..165 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.