DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and nhl-3

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001040817.2 Gene:nhl-3 / 173452 WormBaseID:WBGene00003599 Length:698 Species:Caenorhabditis elegans


Alignment Length:339 Identity:82/339 - (24%)
Similarity:140/339 - (41%) Gaps:76/339 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EQLLTCCVCLDRY----RIPKLLPCQHSFCMEPCMEGLVDYVRR----QVKCPECRAEHRIPYNG 61
            |..|||..||..|    |.||||||.||.|:. |:..|.:....    .::||.||....||..|
 Worm    20 ETFLTCSTCLYTYDGNTRKPKLLPCSHSVCLF-CVTQLAELSPETQPPTLRCPLCREVCPIPAGG 83

  Fly    62 VQAFPTNVTLQRFLE-LHIEITGELPDPTSGQIMERCGVCSEKA--YLSHCAHCEKKICEDCKSA 123
            |..||....:.:.|: :.|:....:|.            ||...  .|.:|..|:...||:|:.:
 Worm    84 VILFPAAFFINQLLDVMQIQRKDVVPS------------CSNHPTDQLLYCETCDLVFCENCQDS 136

  Fly   124 HMD-------------ILRR--EITRFNSQIRRSLHRLQDSLAIIEKNTMSLQTNAISVTEEIDE 173
            .::             .::|  ||..:.::.|  |..|.|:...:.:..:.|..|...:.|:|:.
 Worm   137 VVNKKCDEHTVVPLSIAIKRMSEIVVYRAKGR--LRALDDAHVTVNREIVQLDGNVDKIVEQINA 199

  Fly   174 IYQRITKAIKDRSDQLKGEIDRYLAVELRNLTTLKENLDLEITNITSNCDTVDKYMNETVEWDDC 238
            ..|.::..:::|...|. |..|....|.|.:  ||:.|::          ..|:......|.:.|
 Worm   200 AIQEVSNLVENRRRVLI-ETVRVRRDEKRKV--LKDQLEV----------IQDEKKKLQKELESC 251

  Fly   239 ELMDTKEIFLKTVEFLRHFEYENND--YSRRV------RFL-VSIDPNQLVM----NLATFGDLN 290
            : ||.:.:       .|..:..|:|  :.||:      .|| ::.:..|:::    ||..||.| 
 Worm   252 K-MDIRSM-------ARQLKDGNSDDNWQRRIIEPRENAFLRINTNSEQMLVDVERNLNEFGKL- 307

  Fly   291 IAPHSTPSGGSVSS 304
            .|.::.|...:|.:
 Worm   308 YASNTFPGTSTVEA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093 21/52 (40%)
zf-B_box 94..>122 CDD:279037 8/29 (28%)
iSH2_PI3K_IA_R 131..231 CDD:304922 21/99 (21%)
NHL_TRIM71_like 1234..1517 CDD:271324
YncE 1253..>1517 CDD:225926
NHL repeat 1258..1297 CDD:271324
WD40 repeat 1261..1304 CDD:293791
NHL repeat 1305..1344 CDD:271324
WD40 repeat 1345..1377 CDD:293791
NHL repeat 1352..1388 CDD:271324
NHL repeat 1396..1436 CDD:271324
WD40 repeat 1402..1439 CDD:293791
NHL repeat 1445..1475 CDD:271324
WD40 repeat 1446..1485 CDD:293791
NHL repeat 1491..1517 CDD:271324
nhl-3NP_001040817.2 RING-HC_TRIM32_C-VII 24..74 CDD:319501 19/50 (38%)
Bbox_SF 111..>134 CDD:381767 7/22 (32%)
Smc <164..310 CDD:224117 36/169 (21%)
Filamin <344..422 CDD:366210
NHL 452..696 CDD:302697
NHL repeat 489..528 CDD:271320
NHL repeat 530..570 CDD:271320
NHL repeat 572..610 CDD:271320
NHL repeat 621..659 CDD:271320
NHL repeat 670..695 CDD:271320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133242at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.