DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and TRIM71

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001034200.1 Gene:TRIM71 / 131405 HGNCID:32669 Length:868 Species:Homo sapiens


Alignment Length:310 Identity:121/310 - (39%)
Similarity:176/310 - (56%) Gaps:15/310 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1208 SPTSPTVAAAVAAAGITGAAGTIPKQVYLRKRQQLFQLGGRGSEPGSFTWPRGLAVGPDNSIVVA 1272
            ||....|.:..:..|| |..|              ...|..|...|....|.|::|..:..|:||
Human   574 SPFKVVVKSGRSYVGI-GLPG--------------LSFGSEGDSDGKLCRPWGVSVDKEGYIIVA 623

  Fly  1273 DSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLR 1337
            |.||:|:|||...|.|..:||..|:..|:||..||||.:...:.::||:.|||||:...:|:||.
Human   624 DRSNNRIQVFKPCGAFHHKFGTLGSRPGQFDRPAGVACDASRRIVVADKDNHRIQIFTFEGQFLL 688

  Fly  1338 AFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYI 1402
            .||.:||.:|:|||||.|..::.|.|.|.|..|||:|:|..||.|:.|:|..|......:.|..:
Human   689 KFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGV 753

  Fly  1403 AVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRI 1467
            |.::...::|:|.||||:.:...:.:....:|.||:.:|||..|:|||||.:|.|.||||.|:|:
Human   754 AFNHEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRV 818

  Fly  1468 QIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGNILVCDRENHRVQVF 1517
            |:|..:||||..||:.|||..:.....|:||..:|.|:|.|..|:|:.||
Human   819 QMFESNGSFLCKFGAQGSGFGQMDRPSGIAITPDGMIVVVDFGNNRILVF 868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093
zf-B_box 94..>122 CDD:279037
iSH2_PI3K_IA_R 131..231 CDD:304922
NHL_TRIM71_like 1234..1517 CDD:271324 112/282 (40%)
YncE 1253..>1517 CDD:225926 110/263 (42%)
NHL repeat 1258..1297 CDD:271324 17/38 (45%)
WD40 repeat 1261..1304 CDD:293791 18/42 (43%)
NHL repeat 1305..1344 CDD:271324 16/38 (42%)
WD40 repeat 1345..1377 CDD:293791 15/31 (48%)
NHL repeat 1352..1388 CDD:271324 16/35 (46%)
NHL repeat 1396..1436 CDD:271324 9/39 (23%)
WD40 repeat 1402..1439 CDD:293791 10/36 (28%)
NHL repeat 1445..1475 CDD:271324 16/29 (55%)
WD40 repeat 1446..1485 CDD:293791 22/38 (58%)
NHL repeat 1491..1517 CDD:271324 9/25 (36%)
TRIM71NP_001034200.1 RING-HC_TRIM71_C-VII 8..97 CDD:319503
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..189
Bbox1_TRIM71_C-VII 198..240 CDD:380870
Bbox2_TRIM71_C-VII 277..322 CDD:380854
BBC 314..444 CDD:128778
Filamin 479..580 2/5 (40%)
Filamin 482..577 CDD:395505 2/2 (100%)
NHL_TRIM71_like 584..868 CDD:271324 116/298 (39%)
NHL 1 593..636 17/56 (30%)
NHL repeat 609..648 CDD:271324 17/38 (45%)
NHL 2 640..683 17/42 (40%)
NHL repeat 656..695 CDD:271324 16/38 (42%)
NHL 3 687..730 21/42 (50%)
NHL repeat 703..739 CDD:271324 16/35 (46%)
WD40 repeat 704..740 CDD:293791 16/35 (46%)
NHL 4 734..777 11/42 (26%)
NHL repeat 747..787 CDD:271324 9/39 (23%)
NHL 5 781..824 22/42 (52%)
NHL repeat 796..826 CDD:271324 16/29 (55%)
NHL 6 828..868 15/39 (38%)
NHL repeat 842..868 CDD:271324 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA7J
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133242at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41389
orthoMCL 1 0.900 - - OOG6_105050
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.