DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tn and nhlrc3

DIOPT Version :9

Sequence 1:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster
Sequence 2:XP_002936773.2 Gene:nhlrc3 / 100497010 XenbaseID:XB-GENE-988782 Length:344 Species:Xenopus tropicalis


Alignment Length:257 Identity:67/257 - (26%)
Similarity:102/257 - (39%) Gaps:75/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1257 WPR----------GLAVGPDNSIV-VADSSNH--RVQVFDSNGIFVKEFG------EYGNGEGEF 1302
            ||:          |:||.|.||:| ||....:  :|.||...|.|.:::.      .:|......
 Frog    55 WPKNADYFTGVTFGVAVDPTNSLVYVAQRGENVSKVLVFTEEGYFKQQWNTDSIDMPHGIFAVST 119

  Fly  1303 DCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCD 1367
            |....:.:..:||    ..:.|.::...|.|:.|:..|:.|.:        |...|.|       
 Frog   120 DKEHSIWITDVGQ----GNFGHTVKKYSPSGKLLQVLGTAGKS--------GSALDPL------- 165

  Fly  1368 KENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAVSNTNRVIVSDSN---NHRIQIFDVNGKV 1429
                                       |.:.|..|.|.|:..:.:.|.:   |:||..|..:..:
 Frog   166 ---------------------------QFDQPAEIFVENSGDLYIVDGDGGLNNRILKFTKDFWL 203

  Fly  1430 LSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSW-GSGDSEF 1490
            |.|:||.|:..|||..|..|.||:.|.::|||.||.|:|.|:      ||.|.| |:..|.|
 Frog   204 LWTLGGRGTKPGQFFIPHSVTVDEVGRVWVADRGNKRMQAFD------KTSGEWIGTWSSCF 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnNP_001137707.1 RING 9..54 CDD:238093
zf-B_box 94..>122 CDD:279037
iSH2_PI3K_IA_R 131..231 CDD:304922
NHL_TRIM71_like 1234..1517 CDD:271324 67/257 (26%)
YncE 1253..>1517 CDD:225926 67/257 (26%)
NHL repeat 1258..1297 CDD:271324 15/57 (26%)
WD40 repeat 1261..1304 CDD:293791 14/51 (27%)
NHL repeat 1305..1344 CDD:271324 7/38 (18%)
WD40 repeat 1345..1377 CDD:293791 3/31 (10%)
NHL repeat 1352..1388 CDD:271324 3/35 (9%)
NHL repeat 1396..1436 CDD:271324 12/42 (29%)
WD40 repeat 1402..1439 CDD:293791 13/39 (33%)
NHL repeat 1445..1475 CDD:271324 13/29 (45%)
WD40 repeat 1446..1485 CDD:293791 17/39 (44%)
NHL repeat 1491..1517 CDD:271324 67/257 (26%)
nhlrc3XP_002936773.2 NHL 52..340 CDD:302697 67/257 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.