DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18605 and PEX10

DIOPT Version :9

Sequence 1:NP_001188974.1 Gene:CG18605 / 37189 FlyBaseID:FBgn0034411 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_010551.1 Gene:PEX10 / 851858 SGDID:S000002673 Length:337 Species:Saccharomyces cerevisiae


Alignment Length:36 Identity:11/36 - (30%)
Similarity:19/36 - (52%) Gaps:5/36 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 MKMDGQLVTARIIPSSQ-----ANAPNQGQVNQQTQ 229
            ||.|.:|....::..||     |:||:..|.:|:.:
Yeast     1 MKNDNKLQKEALMRLSQLRFPFADAPSIVQAHQKDE 36

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18605NP_001188974.1 None
PEX10NP_010551.1 PEX10 5..337 CDD:227861 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23350
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.