powered by:
Protein Alignment CG18605 and PEX10
DIOPT Version :9
Sequence 1: | NP_001188974.1 |
Gene: | CG18605 / 37189 |
FlyBaseID: | FBgn0034411 |
Length: | 415 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010551.1 |
Gene: | PEX10 / 851858 |
SGDID: | S000002673 |
Length: | 337 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 36 |
Identity: | 11/36 - (30%) |
Similarity: | 19/36 - (52%) |
Gaps: | 5/36 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 199 MKMDGQLVTARIIPSSQ-----ANAPNQGQVNQQTQ 229
||.|.:|....::..|| |:||:..|.:|:.:
Yeast 1 MKNDNKLQKEALMRLSQLRFPFADAPSIVQAHQKDE 36
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG18605 | NP_001188974.1 |
None |
PEX10 | NP_010551.1 |
PEX10 |
5..337 |
CDD:227861 |
8/32 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23350 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.