DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18605 and topors

DIOPT Version :9

Sequence 1:NP_001188974.1 Gene:CG18605 / 37189 FlyBaseID:FBgn0034411 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_002940310.1 Gene:topors / 734040 XenbaseID:XB-GENE-994244 Length:1018 Species:Xenopus tropicalis


Alignment Length:123 Identity:36/123 - (29%)
Similarity:69/123 - (56%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RHMVQWRIYVYANSLYSLPDRETGDFRGWSPEYFRLNPFEVHRVMMWVNRDVSVLIRTRKADIFY 68
            :.::.:|..:|.:.:.....::.|.:|..|.|:||.||..:||::.|:.|:::||..:..:.:..
 Frog   211 QELINFRRALYRSGIRVRNIQDGGRYRDISAEFFRRNPACLHRLVPWLKRELTVLFGSHGSLVNI 275

  Fly    69 LYETIKNLLPRLKLDSEEFRKPMIHFFGANTDLFIHELINFARSPYDTLMAYECSTQY 126
            :...|.:.:.|..::|:.|.:.:..|....||.||||.:||||.||: :.||:....|
 Frog   276 VQHIIMSNVTRYDMESQAFVEDLRPFLLHRTDHFIHEFVNFARCPYN-IEAYDQHANY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18605NP_001188974.1 None
toporsXP_002940310.1 RING-HC_Topors 59..98 CDD:319488
RING-HC finger (C3HC4-type) 59..97 CDD:319488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003652
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.