DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18605 and Toporsl

DIOPT Version :9

Sequence 1:NP_001188974.1 Gene:CG18605 / 37189 FlyBaseID:FBgn0034411 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001343222.1 Gene:Toporsl / 68274 MGIID:1915524 Length:683 Species:Mus musculus


Alignment Length:157 Identity:39/157 - (24%)
Similarity:74/157 - (47%) Gaps:23/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MVQWRIYVYANSLYSLPDRETGDFRGWSPEYFRLNPFEVHRVMMWVNRDVSVLIRTRKADIFYLY 70
            :|::|..:|.:.::....:.:|..|.:|..||:.||..:||::.|:.|:::.:.    .|..|  
Mouse   132 VVKFRRALYYSGIWVKYVQGSGLKRFFSAHYFKRNPSSLHRLIPWLKRELTAIC----GDYGY-- 190

  Fly    71 ETIKNLL-------PRLKLDSEEFRKPMIHFFGANTDLFIHELINFARSPYDTLMAYECSTQYRA 128
             |:||:|       .:..|:||.|...:..:....|..|:||.|:|..|.|: :..|:.:..|:.
Mouse   191 -TVKNILTAILHHMTKFNLNSEAFTHLLEPYLFQYTQHFLHEFISFVDSSYN-METYDRNAIYQC 253

  Fly   129 LLDFDNGPTTSAKSRDREFLSTRLHSF 155
                    ..|..|:.:..:|....||
Mouse   254 --------PVSKSSKKKSTVSAPAFSF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18605NP_001188974.1 None
ToporslNP_001343222.1 DUF4553 <357..514 CDD:373549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835930
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.