powered by:
Protein Alignment CG18605 and pex10
DIOPT Version :9
Sequence 1: | NP_001188974.1 |
Gene: | CG18605 / 37189 |
FlyBaseID: | FBgn0034411 |
Length: | 415 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001005994.1 |
Gene: | pex10 / 449821 |
ZFINID: | ZDB-GENE-041010-71 |
Length: | 318 |
Species: | Danio rerio |
Alignment Length: | 53 |
Identity: | 13/53 - (24%) |
Similarity: | 22/53 - (41%) |
Gaps: | 7/53 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 KNLLPRLKLDSEEFRKPMIHFFGANTDLFIHELINFARSPYDTLMAYECSTQY 126
:||||..::.....|. :...|.:.|..|...:|...|..:||.|::
Zfish 247 RNLLPSHQVSQSSSRT-------SRCILCLEERRNTTSTPCGHLFCWECITEW 292
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG18605 | NP_001188974.1 |
None |
pex10 | NP_001005994.1 |
Pex2_Pex12 |
18..237 |
CDD:282595 |
|
zf-RING_2 |
265..303 |
CDD:290367 |
8/28 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23350 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.