DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18605 and Topors

DIOPT Version :9

Sequence 1:NP_001188974.1 Gene:CG18605 / 37189 FlyBaseID:FBgn0034411 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001102128.1 Gene:Topors / 362501 RGDID:1305270 Length:1042 Species:Rattus norvegicus


Alignment Length:436 Identity:92/436 - (21%)
Similarity:169/436 - (38%) Gaps:90/436 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MVQWRIYVYANSLYSLPDRETGDFRGWSPEYFRLNPFEVHRVMMWVNRDVSVLIRTRKADIFYLY 70
            ::.:|..:|...:......:.|.:|..|.|:||.||..:||::.|:.|:::||.....:.:..:.
  Rat   257 IINFRRTLYRAGVRVRSIEDGGRYRDISAEFFRRNPACLHRLVPWLKRELTVLFGAHGSLVNIVQ 321

  Fly    71 ETIKNLLPRLKLDSEEFRKPMIHFFGANTDLFIHELINFARSPYDTLMAYECSTQYRALLDFDNG 135
            ..|.:.:.|..|:|:.|...:..|....|:.||||.|:|||||:: :.|::....|      |..
  Rat   322 HIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISFARSPFN-MAAFDQHANY------DCP 379

  Fly   136 PTTSAKSRDREFLSTRLHSFVEFTRRINYDDCGGFEADLEL--------EDEDFGELDDMMMERY 192
            |::...||....:.|           |:.|:....|.|:.:        :||..|.......:.:
  Rat   380 PSSEEGSRSDSSVIT-----------ISPDEAEAQELDVNVSTIRQAPWDDETPGPSYSNSEQVH 433

  Fly   193 GGAPFLM----KMDGQLVT---ARIIPSSQANAPNQGQVNQQTQSQAQAQAQAQAQVQAQAQAQA 250
            .|...|:    ..|.:||:   |..|...|||    ..||..:.|.:. .......|:..|:...
  Rat   434 VGVSSLLNSSDSSDEELVSGGAASQIQGVQAN----DDVNNDSDSSSD-NCVIVGFVKPLAERTP 493

  Fly   251 Q-TQAQTQAQALAQAQAQAQVQAQPQAQVQQA-------AAQPAQLLLPQLTQAVIQTQQRAVHQ 307
            : .:..:.::.|...:....|:.|.|.|...:       |:.|..:|                  
  Rat   494 ELVELSSDSEELGSYEKMETVKTQEQEQSYSSGDSDASRASSPRSVL------------------ 540

  Fly   308 PQQSGQQSGPQHASSTAALATPLEDLELGFAIERSMFVGA---SNADQGGDFILPYGQVFRFANT 369
              ...:|.|..|..|...:.:..|:       :||..:..   |::.:|.....||....|....
  Rat   541 --GKDEQMGKSHCDSDTRINSKKEE-------KRSTSLSTPRDSSSTRGDRACSPYNHRHRKGGR 596

  Fly   370 NRAARPSNGNGSGSGVMNPPPAPPVPNNPRNASAHQGRRRRTQNQR 415
            :|::...:.:.||             ::.||...|.| ::|.:|:|
  Rat   597 SRSSDSRSQSRSG-------------HDQRNHRKHHG-KKRLKNKR 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18605NP_001188974.1 None
ToporsNP_001102128.1 RING 103..146 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339567
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003652
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.