DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18605 and toporsa

DIOPT Version :9

Sequence 1:NP_001188974.1 Gene:CG18605 / 37189 FlyBaseID:FBgn0034411 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001292484.1 Gene:toporsa / 324197 ZFINID:ZDB-GENE-030131-6401 Length:999 Species:Danio rerio


Alignment Length:372 Identity:75/372 - (20%)
Similarity:140/372 - (37%) Gaps:61/372 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMPRHMVQWRIYVYANSLYSLPDRET--------------------GDFRGWSPEYFRLNPFEVH 45
            |:.|..|:.|......||.||.|:|.                    |..|..|.|:|:.||..:|
Zfish   149 MIRRLTVRQRRESEGRSLRSLQDQEVVKFRRALYRRGVQVQSVQDGGRTRETSAEFFKRNPACLH 213

  Fly    46 RVMMWVNRDVSVLIRTRKADIFYLYETIKNLLPRLKLDSEEFRKPMIHFFGANTDLFIHELINFA 110
            |::.|:.|:::||.....:.:..:...|..|:.|..||.:..:..:..|..::|:.|:||.::||
Zfish   214 RLVPWLRRELTVLYGAHGSLVNIVQHIIMTLITRHNLDDQAVQHELRPFLLSHTEHFLHEFLSFA 278

  Fly   111 RSP-----YDTLMAY-------ECSTQYRALLDFDNGPTTSAKSRDREFLSTRLHS----FVEFT 159
            |||     ||....|       |.|:...:::......:.|..|..::|.:.|:.|    :.:.|
Zfish   279 RSPFNMEAYDQRAVYDLPRPSGESSSSENSVIAISEDESESLVSGAQDFATPRVTSSQTAWDDET 343

  Fly   160 RRINYDDCGGFEADLELEDEDFGELDDMMMERYGGAPFLMKMDGQLVTARIIPSSQANAPNQGQ- 223
            ...:|.........:.:.|.|   .|..:.|.......:...|.....:.|.|....::.|... 
Zfish   344 PGPSYSSERSQVLPVHVRDSD---SDSSVGEAVMPIAAVRHQDHPANPSTIQPEEDHSSSNDEDC 405

  Fly   224 --------VNQQTQSQAQAQAQAQAQVQAQAQAQAQTQAQTQAQALAQAQAQAQVQAQPQAQVQQ 280
                    |.::|....|..:.::.....|..:...:||....:.::.:.|......:|    .:
Zfish   406 VIIGYVKPVAERTPELVQLSSDSENSETEQNASPRNSQAPQHIRFISDSDASPTASQRP----LR 466

  Fly   281 AAAQPAQLLLPQLTQAVIQTQQRAVHQPQQSGQQSGPQ-----HASS 322
            ..|..::    ......||.::.:.:....||.:.|..     |:||
Zfish   467 GPASSSR----SFEDTSIQLRKNSKYDNTFSGSREGSSQSKRIHSSS 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18605NP_001188974.1 None
toporsaNP_001292484.1 RING-HC_Topors 28..67 CDD:319488
RING-HC finger (C3HC4-type) 28..66 CDD:319488
RRM 635..>749 CDD:330708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003652
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.