powered by:
Protein Alignment CG18605 and pas4
DIOPT Version :9
Sequence 1: | NP_001188974.1 |
Gene: | CG18605 / 37189 |
FlyBaseID: | FBgn0034411 |
Length: | 415 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_595592.1 |
Gene: | pas4 / 2539774 |
PomBaseID: | SPBC17A3.10 |
Length: | 306 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 58 |
Identity: | 13/58 - (22%) |
Similarity: | 29/58 - (50%) |
Gaps: | 5/58 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 IKNLLPRLKLDSEEFRKPMIHFFGANTDLFIHELINFARSPYDTLMAYECSTQYRALL 130
::||||...:..| |.:::...:...:.: :|::..|....|:..: |:|..:.||
pombe 133 LRNLLPEAVISKE---KHLVYILNSFKPILL-KLVSIIRFLCLTMKGH-CATVSQLLL 185
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG18605 | NP_001188974.1 |
None |
pas4 | NP_595592.1 |
PEX10 |
1..306 |
CDD:227861 |
13/58 (22%) |
RING |
255..295 |
CDD:238093 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23350 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.