DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18605 and pex10

DIOPT Version :9

Sequence 1:NP_001188974.1 Gene:CG18605 / 37189 FlyBaseID:FBgn0034411 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_002936605.1 Gene:pex10 / 100487506 XenbaseID:XB-GENE-954175 Length:324 Species:Xenopus tropicalis


Alignment Length:35 Identity:12/35 - (34%)
Similarity:18/35 - (51%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 RIIPSSQANAPNQGQVNQQTQSQAQAQAQAQAQVQ 243
            ::|.|||.:...||.:..|.....||.|.|:..:|
 Frog     8 QLIRSSQKDEQFQGSLRGQAHEVCQAFAGAKKWLQ 42

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18605NP_001188974.1 None
pex10XP_002936605.1 Pex2_Pex12 16..215 CDD:368100 8/27 (30%)
RING-HC_PEX10 270..309 CDD:319441
RING-HC finger (C3HC4-type) 271..308 CDD:319441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23350
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.