powered by:
Protein Alignment CG18605 and pex10
DIOPT Version :9
Sequence 1: | NP_001188974.1 |
Gene: | CG18605 / 37189 |
FlyBaseID: | FBgn0034411 |
Length: | 415 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002936605.1 |
Gene: | pex10 / 100487506 |
XenbaseID: | XB-GENE-954175 |
Length: | 324 |
Species: | Xenopus tropicalis |
Alignment Length: | 35 |
Identity: | 12/35 - (34%) |
Similarity: | 18/35 - (51%) |
Gaps: | 0/35 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 209 RIIPSSQANAPNQGQVNQQTQSQAQAQAQAQAQVQ 243
::|.|||.:...||.:..|.....||.|.|:..:|
Frog 8 QLIRSSQKDEQFQGSLRGQAHEVCQAFAGAKKWLQ 42
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23350 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.