powered by:
Protein Alignment Topors and PEX10
DIOPT Version :9
Sequence 1: | NP_001261083.1 |
Gene: | Topors / 37188 |
FlyBaseID: | FBgn0267351 |
Length: | 1038 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_722540.1 |
Gene: | PEX10 / 5192 |
HGNCID: | 8851 |
Length: | 346 |
Species: | Homo sapiens |
Alignment Length: | 59 |
Identity: | 24/59 - (40%) |
Similarity: | 31/59 - (52%) |
Gaps: | 4/59 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 AAEENGTVERNSPPPNCAICLSRCRRKCFTDSCMHQFCFKCLCEWSKIKPECPLCKQPF 144
|:.|...|.|| |.|.:||.. ||......|.|.||::|:..|...|.|||||::.|
Human 280 ASLEERAVSRN---PLCTLCLEE-RRHPTATPCGHLFCWECITAWCSSKAECPLCREKF 334
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Topors | NP_001261083.1 |
RING |
102..144 |
CDD:238093 |
17/41 (41%) |
PEX10 | NP_722540.1 |
Pex2_Pex12 |
18..263 |
CDD:282595 |
|
RING |
293..334 |
CDD:238093 |
17/41 (41%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23350 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.