DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Topors and TOPORS

DIOPT Version :10

Sequence 1:NP_611388.1 Gene:Topors / 37188 FlyBaseID:FBgn0267351 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_005793.2 Gene:TOPORS / 10210 HGNCID:21653 Length:1045 Species:Homo sapiens


Alignment Length:286 Identity:55/286 - (19%)
Similarity:106/286 - (37%) Gaps:81/286 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   697 RSHSRSRSNYKHRSSRRHR------SSRSRRDGSERDRSKPPKEPPEPAEPPLVVGPIGPRSPPE 755
            ::|..:.:.|..:.::||:      ::.:.:..|:...|..|.:|.:.|.||:         |..
Human    13 QTHLENPTKYHIQQAQRHQVKQYLSTTLANKHASQVLSSPCPNQPGDHAMPPV---------PGS 68

  Fly   756 PAPQMPPAA----AQGEPEA-----EVGMVAGGPPPPPEPPNGIGAAMDDEDEEPSMVSESFKKH 811
            .||..|.|.    :..|.||     |........|............|||..::...:..|:.:.
Human    69 SAPNSPMAMLTLNSNCEKEAFYKFEEQSRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE 133

  Fly   812 RIIVRTDTLGAKTTKEIEEEVRERLLRQ------------------QMERELEKRKERELEKQKE 858
            .:.:....|....|..:...:.:....|                  .::|||.:.:.|.|.|:::
Human   134 ILGLMDPALQMANTLPVSGNLIDLYSNQGLPPPGLTISNSCPANLPNIKRELTESEARALAKERQ 198

  Fly   859 RE-----LEKRKERELEKR-KE----------------------------RELEKHQER--ELQK 887
            ::     :|:|:...:..| ||                            |:|::.|:|  :|:.
Human   199 KKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKDLEN 263

  Fly   888 RKERELEKHQERELQKR-KERELQKR 912
            | :::|| |..|.|..| :|.|:|.|
Human   264 R-QKKLE-HANRHLLLRVQELEMQAR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ToporsNP_611388.1 RING-HC_Topors 99..144 CDD:438236
TOPORSNP_005793.2 E3 ubiquitin-protein ligase activity 1..195 33/190 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 4/21 (19%)
Required for DNA-binding 51..374 50/248 (20%)
RING-HC_Topors 100..145 CDD:438236 6/44 (14%)
Interaction with SUMO1. /evidence=ECO:0000269|PubMed:14516784 437..654
Required for sumoylation and localization to discrete nuclear foci 437..574
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 442..475
Interaction with TOP1. /evidence=ECO:0000269|PubMed:10352183 456..882
Interaction with p53/TP53. /evidence=ECO:0000269|PubMed:10415337 456..731
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 511..692
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 713..936
Interaction with UBE2I. /evidence=ECO:0000269|PubMed:14516784 854..917
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.