DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Topors and pex10

DIOPT Version :9

Sequence 1:	NP_001261083.1	Gene:	Topors / 37188	FlyBaseID:	FBgn0267351	Length:	1038	Species:	Drosophila melanogaster
Sequence 2:	XP_002936605.1	Gene:	pex10 / 100487506	XenbaseID:	XB-GENE-954175	Length:	324	Species:	Xenopus tropicalis

Alignment Length:	58	Identity:	22/58 - (37%)
Similarity:	30/58 - (51%)	Gaps:	9/58 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    95 RNSPP--------PNCAICLSRCRRKCFTDSCMHQFCFKCLCEWSKIKPECPLCKQPF 144
            :.:||        ..|.:|| ..||.|....|.|.||::|:.||...|.|||||::.|
Frog   256 QRAPPHEKSYKRRAKCTLCL-EVRRHCTATPCGHLFCWECITEWCNTKTECPLCREKF 312

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Topors	NP_001261083.1	RING	102..144	CDD:238093	19/41 (46%)
pex10	XP_002936605.1	Pex2_Pex12	16..215	CDD:368100
		RING-HC_PEX10	270..309	CDD:319441	18/39 (46%)
		RING-HC finger (C3HC4-type)	271..308	CDD:319441	17/37 (46%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23350
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	3.010