DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DptB and CG33493

DIOPT Version :9

Sequence 1:NP_523787.2 Gene:DptB / 37184 FlyBaseID:FBgn0034407 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_996038.1 Gene:CG33493 / 2768994 FlyBaseID:FBgn0053493 Length:102 Species:Drosophila melanogaster


Alignment Length:68 Identity:19/68 - (27%)
Similarity:27/68 - (39%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VPLHRVRRQFQLN-GGGGGSPKQGFDLSLNGRAPVWQSPNGRHSFDATGSYAQHLGGPY---GNS 106
            ||  |.|||..|. ........:..:|:|...|.:|.|.:.|...|.:.|......|..   |::
  Fly    21 VP--RQRRQIDLTVSAEHDDNDEETELALEAIAGLWSSADSRTKIDGSASLVHRTHGTQSGTGST 83

  Fly   107 RPQ 109
            |.|
  Fly    84 RYQ 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DptBNP_523787.2 Attacin_C <70..120 CDD:281726 12/43 (28%)
CG33493NP_996038.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.