powered by:
Protein Alignment DptB and CG33493
DIOPT Version :9
Sequence 1: | NP_523787.2 |
Gene: | DptB / 37184 |
FlyBaseID: | FBgn0034407 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_996038.1 |
Gene: | CG33493 / 2768994 |
FlyBaseID: | FBgn0053493 |
Length: | 102 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 19/68 - (27%) |
Similarity: | 27/68 - (39%) |
Gaps: | 6/68 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 VPLHRVRRQFQLN-GGGGGSPKQGFDLSLNGRAPVWQSPNGRHSFDATGSYAQHLGGPY---GNS 106
|| |.|||..|. ........:..:|:|...|.:|.|.:.|...|.:.|......|.. |::
Fly 21 VP--RQRRQIDLTVSAEHDDNDEETELALEAIAGLWSSADSRTKIDGSASLVHRTHGTQSGTGST 83
Fly 107 RPQ 109
|.|
Fly 84 RYQ 86
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
DptB | NP_523787.2 |
Attacin_C |
<70..120 |
CDD:281726 |
12/43 (28%) |
CG33493 | NP_996038.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.