DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DptA and DptB

DIOPT Version :9

Sequence 1:NP_476808.1 Gene:DptA / 37183 FlyBaseID:FBgn0004240 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_523787.2 Gene:DptB / 37184 FlyBaseID:FBgn0034407 Length:120 Species:Drosophila melanogaster


Alignment Length:120 Identity:52/120 - (43%)
Similarity:63/120 - (52%) Gaps:17/120 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQFTIAVAL--LCCAIASTLAYPMPDD---MTMKPTP---PPQY--PLN-------LQGGGGGQS 48
            |.||.::..  |.||.:|..|||.||.   :.::|.|   .|.:  ||:       |.|||||..
  Fly     1 MHFTASLLFIGLACAFSSAWAYPYPDPREIVNLQPEPLAYAPNFDVPLHRVRRQFQLNGGGGGSP 65

  Fly    49 GDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRF 103
            ..||..::.|...||.|.||||.....|.|.||||||||||.|.|..|..||:||
  Fly    66 KQGFDLSLNGRAPVWQSPNGRHSFDATGSYAQHLGGPYGNSRPQWGAGGVYTFRF 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DptANP_476808.1 None
DptBNP_523787.2 Attacin_C <70..120 CDD:281726 25/49 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019584
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.