powered by:
Protein Alignment DptA and AttA
DIOPT Version :9
Sequence 1: | NP_476808.1 |
Gene: | DptA / 37183 |
FlyBaseID: | FBgn0004240 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_523745.1 |
Gene: | AttA / 36636 |
FlyBaseID: | FBgn0012042 |
Length: | 221 |
Species: | Drosophila melanogaster |
Alignment Length: | 55 |
Identity: | 14/55 - (25%) |
Similarity: | 25/55 - (45%) |
Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 GDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRF 103
|.|....:.|...:|:|.|....:.|.|...:...||:.|.:|::..|...::.|
Fly 166 GIGQQLGLDGRANLWSSPNRATTLDLTGSASKWTSGPFANQKPNFGAGLGLSHHF 220
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
DptA | NP_476808.1 |
None |
AttA | NP_523745.1 |
Attacin_N |
34..99 |
CDD:281725 |
|
Attacin_C |
101..220 |
CDD:281726 |
13/53 (25%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.