DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DptA and AttA

DIOPT Version :9

Sequence 1:NP_476808.1 Gene:DptA / 37183 FlyBaseID:FBgn0004240 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_523745.1 Gene:AttA / 36636 FlyBaseID:FBgn0012042 Length:221 Species:Drosophila melanogaster


Alignment Length:55 Identity:14/55 - (25%)
Similarity:25/55 - (45%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRF 103
            |.|....:.|...:|:|.|....:.|.|...:...||:.|.:|::..|...::.|
  Fly   166 GIGQQLGLDGRANLWSSPNRATTLDLTGSASKWTSGPFANQKPNFGAGLGLSHHF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DptANP_476808.1 None
AttANP_523745.1 Attacin_N 34..99 CDD:281725
Attacin_C 101..220 CDD:281726 13/53 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.