DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and YNR064C

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_014462.1 Gene:YNR064C / 855801 SGDID:S000005347 Length:290 Species:Saccharomyces cerevisiae


Alignment Length:260 Identity:67/260 - (25%)
Similarity:105/260 - (40%) Gaps:50/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 LLLLHGWPGSVREFFDFIPMLTKHSNITDYAFEVVAPSLVGYGWSDAATRPGFNAAEMATVMRNL 221
            :|||||:|.|...|.:.||:|...       |.::||.|.|:|:::......|:...:...:..|
Yeast    32 ILLLHGFPTSSNMFRNLIPLLAGQ-------FHIIAPDLPGFGFTETPENYKFSFDSLCESIGYL 89

  Fly   222 MLRLGHKKFFIQGGDWGSIIGSNLATLYPENVIGYHSNMCVLHTPLAILKGIYGSFF-PEK---- 281
            :..|..:||.:...|:||.:|..||..:|..:.|     .|.....|..:|:...|: |.|    
Yeast    90 LDTLSIEKFAMYIFDYGSPVGFRLALKFPSRITG-----IVTQNGNAYEEGLDDRFWGPLKEYWK 149

  Fly   282 -YLPSRFFVDHHFPVWEKWLELL--EESGYFHIQATKPD--TIGAALT----SSPVGLASYI--- 334
             |.....||....|..|....::  ...|...|::..|.  |:..||.    .:.:.|..:.   
Yeast   150 SYQSDPVFVKSLIPYLEDPANVICQYHDGVPAIESVDPAAYTLDIALIQRTGQTDIQLRLFFDYQ 214

  Fly   335 --------LEKFQTCTNPGLKQDFGAIVTVF---GLEAV---LDNL-MVYYLTNSATTAARFYLE 384
                    .:||...:...:...:||..|:|   |.||.   :||| :|||.|      ..|.||
Yeast   215 NNIKLYPAFQKFLRDSKIPVLVAWGANDTIFSVAGAEAYRKDVDNLKVVYYDT------GHFALE 273

  Fly   385  384
            Yeast   274  273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 5/7 (71%)
Abhydrolase 135..>251 CDD:304388 28/93 (30%)
YNR064CNP_014462.1 Abhydrolase_1 30..275 CDD:395444 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2784
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2361
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.