DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and AT5G21950

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001331426.1 Gene:AT5G21950 / 832255 AraportID:AT5G21950 Length:360 Species:Arabidopsis thaliana


Alignment Length:100 Identity:32/100 - (32%)
Similarity:53/100 - (53%) Gaps:13/100 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 LLLLHGW-PGSVREFFDFIPMLTKHSNITDYAFEVVAPSLVGYGWSDAATRPGFNAAEM--ATVM 218
            ||||||: |.:|.::...:..|:       :.|.:..|.||.:|.|.::   |.|.:||  |..|
plant   109 LLLLHGFGPSAVWQWSHQVKPLS-------HFFRLYVPDLVFFGGSSSS---GENRSEMFQALCM 163

  Fly   219 RNLMLRLGHKKFFIQGGDWGSIIGSNLATLYPENV 253
            ..||.:|..::|.:.|..:|..:..|:|.::||.|
plant   164 GKLMEKLEVERFSVVGTSYGGFVAYNMAKMFPEKV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 6/8 (75%)
Abhydrolase 135..>251 CDD:304388 29/96 (30%)
AT5G21950NP_001331426.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.