DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and AT3G51000

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_190669.1 Gene:AT3G51000 / 824264 AraportID:AT3G51000 Length:323 Species:Arabidopsis thaliana


Alignment Length:394 Identity:86/394 - (21%)
Similarity:139/394 - (35%) Gaps:133/394 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 NSFKQYKTEIQGLNIHYIHEKVSEEAKEKKHVYPL-LLLHGWPG---SVREFFDFIPMLTKHSNI 183
            :|.::.|.:..|:.:: :.||..||.       || |||||:|.   |.|...||         :
plant     3 SSVREKKIKTNGIWLN-VAEKGDEEG-------PLVLLLHGFPETWYSWRHQIDF---------L 50

  Fly   184 TDYAFEVVAPSLVGYGWSDA-ATRPGFNAAEMATVMRNLMLRLGHKKFFIQGGDWGSIIGSNLAT 247
            :.:.:.||||.|.|||.||: .:...:..:.:...:..|:...|..:.|:.|.|||:|||..|..
plant    51 SSHGYHVVAPDLRGYGDSDSLPSHESYTVSHLVADVIGLLDHYGTTQAFVAGHDWGAIIGWCLCL 115

  Fly   248 LYPENVIGYHSNMCVLHTPLAILKGIYGSFFPE--KYLPSRFFVDHHFPVWEKWLELLEESGYFH 310
            ..|:.|.|:.|    |..|          :||.  |..||.||             .:...|.:.
plant   116 FRPDRVKGFIS----LSVP----------YFPRDPKLKPSDFF-------------KIFGDGLYI 153

  Fly   311 IQATKPDTIGAALTSSPVGLASYILEKFQTCTNPGLKQDFGAIVTVFGLEAVLDNLMVYYLTNSA 375
            .|..||....||.....   ...:::||...|    :.|:        |.|..|..::.:|...:
plant   154 TQFQKPGRAEAAFAKHD---CLSVMKKFLLIT----RTDY--------LVAPPDTEIIDHLEIPS 203

  Fly   376 T-------TAARFYLENVSKT--------YRDLQLD-RVQSPVPMGCARFRFDLASVTDWQ---- 420
            |       ...:.|.|...::        ||.:.:: .:.:|                 ||    
plant   204 TIPDWITEEEIQVYAEKFQRSGFTGPLNYYRSMDMNWEILAP-----------------WQDSKI 251

  Fly   421 -LRDKF----------------------------PNLTHSMYFQQGSHFAALEMPAMLFNDFTAF 456
             :..||                            ||| ..:..:.|.||...|....:..:..:|
plant   252 VVPTKFIAGDKDIGYEGPNGTMEYVKGEVFKIVVPNL-EIVVIEGGHHFIQQEKSEQVSQEILSF 315

  Fly   457 VGKI 460
            :.|:
plant   316 LNKL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 14/42 (33%)
Abhydrolase 135..>251 CDD:304388 37/120 (31%)
AT3G51000NP_190669.1 MhpC 10..319 CDD:223669 83/385 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto2959
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.