DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and AT3G05600

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_187211.1 Gene:AT3G05600 / 819726 AraportID:AT3G05600 Length:331 Species:Arabidopsis thaliana


Alignment Length:391 Identity:86/391 - (21%)
Similarity:128/391 - (32%) Gaps:150/391 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 IQGLNIHYIHEKVSEEAKEKKHVYPLLLLHGWPGSVREFFDFIPMLTKH--SNITDYAFEVVAPS 194
            :.|:.:| |.||..:|..      .:|||||:|.        :....:|  |.::...:..|||.
plant    11 VNGITMH-IAEKGPKEGP------VVLLLHGFPD--------LWYTWRHQISGLSSLGYRAVAPD 60

  Fly   195 LVGYGWSDAATRPGFNAAEMATVMRNLMLRL-----GHKKFFIQGGDWGSIIGSNLATLYPENVI 254
            |.|||.||:.  ..|:......|:.:|:..|     ..:|.|:.|.|||:|||..|....||.:.
plant    61 LRGYGDSDSP--ESFSEYTCLNVVGDLVALLDSVAGNQEKVFLVGHDWGAIIGWFLCLFRPEKIN 123

  Fly   255 GYHSNMCVLHTPLAI----LKGIYG--SFFPEKYLPSRFFVDHHFPVWEKWLELLEESGYFHIQA 313
            |:   :| |..|...    :|.:.|  :.|.:.|...||                :|.|....:.
plant   124 GF---VC-LSVPYRSRNPKVKPVQGFKAVFGDDYYICRF----------------QEPGKIEGEI 168

  Fly   314 TKPD------------TIGAAL--TSSPVGLASYILEKFQTCTNPG----------LKQDFGAIV 354
            ...|            |:|..:  ..:|.|      ||    .||.          .|:|     
plant   169 ASADPRIFLRNLFTGRTLGPPILPKDNPFG------EK----PNPNSENIELPEWFSKKD----- 218

  Fly   355 TVFGLEAVLDNLMVYYLTNSATTAARFYLENVSKT--------YRDLQLD----------RVQSP 401
                    ||                ||:....|.        ||.:.|:          ::|.|
plant   219 --------LD----------------FYVSKFEKAGFTGGLNYYRAMDLNWELTAPWTGAKIQVP 259

  Fly   402 VPMGCARFR---FDLASVTDWQ--------LRDKFPNLTHSMYFQQGSHFAALEMPAML---FND 452
            |     :|.   ||:...|...        .....|.|...:..:...||...|.|..:   .||
plant   260 V-----KFMTGDFDMVYTTPGMKEYIHGGGFAADVPTLQEIVVIEDAGHFVNQEKPQEVTAHIND 319

  Fly   453 F 453
            |
plant   320 F 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 11/32 (34%)
Abhydrolase 135..>251 CDD:304388 36/122 (30%)
AT3G05600NP_187211.1 MhpC 6..324 CDD:223669 86/391 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.