DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and SEH

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_180242.1 Gene:SEH / 817215 AraportID:AT2G26740 Length:321 Species:Arabidopsis thaliana


Alignment Length:387 Identity:74/387 - (19%)
Similarity:123/387 - (31%) Gaps:127/387 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KTEIQGLNIHYIHEKVSEEAKEKKHVYPL-LLLHGWPGSVREFFDFIPMLTKHSNITDYAFEVVA 192
            |....|::||...:..|:.        |: |||||:|.....:...||.|...      .:..||
plant     5 KVRGNGIDIHVAIQGPSDG--------PIVLLLHGFPELWYSWRHQIPGLAAR------GYRAVA 55

  Fly   193 PSLVGYGWSDA----ATRPGFNAAEMATVMRNLMLRLGHKKFFIQGGDWGSIIGSNLATLYPENV 253
            |.|.|||.|||    ::...||.......:.:.:.....:|.|:.|.|||::|...|....|:.|
plant    56 PDLRGYGDSDAPAEISSYTCFNIVGDLIAVISALTASEDEKVFVVGHDWGALIAWYLCLFRPDRV 120

  Fly   254 IGYHSNMCVLHTPLAILKGIYGSFFPEKYLPSRFFVDHHFPVWEKWLELLEESGYFHIQATKPDT 318
                             |.:.....|                             |..:.|.|..
plant   121 -----------------KALVNLSVP-----------------------------FSFRPTDPSV 139

  Fly   319 IGAALTSSPVG-LASYILEKFQTCTNPGLKQDFG---AIVTVFGLEAVLDNLMVY---------- 369
                   .||. :.::..:.:..|.    .|:||   |.:...|.|.|:..|:.|          
plant   140 -------KPVDRMRAFYGDDYYICR----FQEFGDVEAEIAEVGTERVMKRLLTYRTPGPVIIPK 193

  Fly   370 ----------------YLTNS--ATTAARFYLENVS---KTYRDLQLD----------RVQSPVP 403
                            :||..  |...::|..:..|   ..||:...:          ::|.|..
plant   194 DKSFWGSKGETIPLPSWLTEEDVAYFVSKFEEKGFSGPVNYYRNFNRNNELLGPWVGSKIQVPTK 258

  Fly   404 --MGCARFRFDLASVTDW----QLRDKFPNLTHSMYFQQGSHFAALEMPAMLFNDFTAFVGK 459
              :|.....:.:..|.::    |.::..|.|...:..:..:||...|.|..:......|:.|
plant   259 FVIGELDLVYYMPGVKEYIHGPQFKEDVPLLEEPVVMEGVAHFINQEKPQEILQIILDFISK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 11/36 (31%)
Abhydrolase 135..>251 CDD:304388 33/120 (28%)
SEHNP_180242.1 MhpC 2..318 CDD:223669 72/383 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.