DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and Ephx3

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001028335.1 Gene:Ephx3 / 71932 MGIID:1919182 Length:424 Species:Mus musculus


Alignment Length:226 Identity:58/226 - (25%)
Similarity:86/226 - (38%) Gaps:66/226 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GLNIHYIHEKVSEEAKEKKHVYPLLL-LHGWPGS-------VREFFDFIPMLTKHSNITDYAFEV 190
            ||.:||:.......        ||:| |||:|.:       :|||       ..|       |.|
Mouse   148 GLRLHYVSAGHGNG--------PLMLFLHGFPENWFSWRYQLREF-------QSH-------FHV 190

  Fly   191 VAPSLVGYGWSDAATRPGFNAAEMATV------MRNLMLRLGHKKFFIQGGDWGSIIGSNLATLY 249
            ||..:.||..|||.     ...:..|:      :::.:|.||:.|..:...|||:.:....:..|
Mouse   191 VAVDMRGYSPSDAP-----KEVDCYTIDLLLDDIKDTILGLGYSKCILVSHDWGASLAWEFSIYY 250

  Fly   250 PENVIGYHSNMCVLH-TPLAILK--GIY--GSFFPEKYLPSRFFVDHHFPVWEKWL--ELLEESG 307
            |..|    ..|.|.: .|:::::  .|:  |..|...|:         |.....||  :||..|.
Mouse   251 PSLV----ERMVVANGPPMSVIQEYSIHHIGQIFRSNYM---------FLFQLPWLPEKLLSMSD 302

  Fly   308 YFHIQATKPDTIGAALTSSPVGLASYILEKF 338
            :   |..| ||........| ||....||.|
Mouse   303 F---QILK-DTFTHRKNGIP-GLTPSELEAF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 10/31 (32%)
Abhydrolase 135..>251 CDD:304388 32/129 (25%)
Ephx3NP_001028335.1 Abhydrolase 139..>262 CDD:304388 37/144 (26%)
MhpC 144..415 CDD:223669 58/226 (26%)
Abhydrolase <341..424 CDD:304388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2361
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.