DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and Serhl

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_075964.1 Gene:Serhl / 68607 MGIID:1890404 Length:311 Species:Mus musculus


Alignment Length:350 Identity:66/350 - (18%)
Similarity:121/350 - (34%) Gaps:110/350 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PLLLLHGWPGSVREFFDFIPMLTKHSNITDYAFEVVAPSLVGYGWSDAATRPG--FNAAEMATVM 218
            |:|.||||..:...|...||:|.:     |:.:  :|....|:|.| :...||  :......:.:
Mouse    28 PVLCLHGWLDNANSFDRLIPLLPQ-----DFCY--MAMDFGGHGLS-SHYNPGLPYYQQNFVSEV 84

  Fly   219 RNLMLRLGHKKFFIQGGDWGSIIGSNLATLYP---------------------ENVIGYHSNMCV 262
            |.:.......:|.:.|..:|..:|...|.::|                     ||::.|.... :
Mouse    85 RRVATAFKWNQFTLLGHSFGGCVGGTFACMFPEMVDKLILLDSTPFFLDSNEMENILTYRRRN-I 148

  Fly   263 LHT--PLAILKGIYGSFFPEKYLPSRFFVDHHFPVWEKWLELLEESGYFHIQATKPDTIGAALTS 325
            .||  ..|..|....:..||:.|..  |::::..:.:...||:.:.|     .||.|        
Mouse   149 EHTLQVEASQKKSLRAVSPEEMLQG--FLNNNSHLDKDCGELILQRG-----TTKVD-------- 198

  Fly   326 SPVGLASYILEKFQTCTNPGLKQDFGA----IVTVFGLEA---VLDNLMVYYLTNSATTAAR--- 380
                 |..:|.:.:..:.|....||.:    :.:...|:|   ::..|..||....|..|.:   
Mouse   199 -----AGLVLNRDRRISWPENSFDFVSKEMFVHSAKSLQASVLMIKALQGYYDVRRANDADKAPM 258

  Fly   381 -FYLENVSKTYRDLQLDRVQSPVPMGCARFRFDLASVTDWQLRDKFPNLTHSMYFQQGSHFAALE 444
             |.::.:..|.::                 ||....|                   .|:|:..:.
Mouse   259 HFMVDTLRSTLKE-----------------RFQFVEV-------------------PGNHYIHMN 287

  Fly   445 MPAMLFNDFTAFVGKIG--LHGEKR 467
            .|.::       .|.:|  |.|.:|
Mouse   288 KPQVV-------AGVVGPFLQGLQR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 6/8 (75%)
Abhydrolase 135..>251 CDD:304388 24/117 (21%)
SerhlNP_075964.1 MhpC 15..303 CDD:223669 64/346 (18%)
Abhydrolase_5 28..>129 CDD:289465 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.