DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and ABHD4

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_071343.2 Gene:ABHD4 / 63874 HGNCID:20154 Length:342 Species:Homo sapiens


Alignment Length:363 Identity:68/363 - (18%)
Similarity:126/363 - (34%) Gaps:119/363 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LEQFVDYWRDNYLTKWDERQELFNSFKQYKTEI-QGLNIHYIHEKVS----------EEAKEKKH 153
            |||....|..::|..|  |....:..|..:..| |.|...::...||          ..:.|:..
Human     5 LEQQSQGWLSSWLPTW--RPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQND 67

  Fly   154 VYPLLLLHGWPGSVREFFDFIPMLTKHSNITDYAFEVVAPSLVGYGWSDAATRPGF------NAA 212
            ..||:::||:.|.|..:  .:.|.:..:..|.:.|:     |:|:|.|   :||.|      ...
Human    68 RTPLVMVHGFGGGVGLW--ILNMDSLSARRTLHTFD-----LLGFGRS---SRPAFPRDPEGAED 122

  Fly   213 EMATVMRNLMLRLGHKKFFIQGGDWGSIIGSNLATLYPE-------------------------- 251
            |..|.:......:|.....:.|...|..:.::.:..||:                          
Human   123 EFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAP 187

  Fly   252 --------NVIGYHSNMCVLHTPLAILK--GIYGSFFPEKYLP--SRFFVDHHFPVWEKWLELLE 304
                    :|:| .||      |||:|:  |.:|....:::.|  .|.|.|              
Human   188 PAWVKAVASVLG-RSN------PLAVLRVAGPWGPGLVQRFRPDFKRKFAD-------------- 231

  Fly   305 ESGYFHIQATKPDTIGAAL----TSSPVGLASY--ILEKFQTCTNPGL------KQDFGAIVTVF 357
               :|     :.|||...:    ..:|.|..::  ::|.|.....|.|      ::|. .|..::
Human   232 ---FF-----EDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDV-PITMIY 287

  Fly   358 GLEAVLDNLMVYYLTNSATTAARFYLENVSKTYRDLQL 395
            |.:..:|          .:|..:..::......||:::
Human   288 GSDTWID----------TSTGKKVKMQRPDSYVRDMEI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 18/75 (24%)
Abhydrolase 135..>251 CDD:304388 26/131 (20%)
ABHD4NP_071343.2 PLN02894 8..338 CDD:215484 65/360 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.