DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and abhd4

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001017287.1 Gene:abhd4 / 550041 XenbaseID:XB-GENE-921768 Length:342 Species:Xenopus tropicalis


Alignment Length:345 Identity:71/345 - (20%)
Similarity:122/345 - (35%) Gaps:135/345 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LEQFVDYWRDNYLTKW-----------DER--QELFNSFK-QY-----KTEIQGLNIHYIHEKVS 145
            ||:....|...::..|           :.|  |.:.|.|. ||     :.:|..|.       ||
 Frog     5 LEEHNQNWLTGWIPSWCPTSMSKLKAVESRILQCIKNKFSAQYVSLPDQNKIWTLT-------VS 62

  Fly   146 EEAKEKKHVYPLLLLHGWPGSVREFFDFIPMLTKHSNITDYAFEVVAPSLVGYGWSDAATRPGF- 209
            .|.::|.   ||:::||:.|.:..:...:..|:  |:.|.:||:     |:|:|.|   :||.| 
 Frog    63 PELQKKT---PLVMVHGFGGGIGLWIQNLDHLS--SSRTLHAFD-----LLGFGRS---SRPNFP 114

  Fly   210 ---NAAEMATV-----------MRNLMLRLGHKKFFIQGGDWGSIIGSNLATLYPEN-------- 252
               ..||...|           :||::| |||        ..|..:.::.:..:||.        
 Frog   115 SDPEGAEEQFVSSIEQWREQMGIRNMIL-LGH--------SLGGFLAASYSIKFPERVKHLILVD 170

  Fly   253 --------------------------VIGYHSNMCVLHTPLAILK--GIYGSFFPEKYLPSRFFV 289
                                      |:| .||      |||:::  |.:|....:::.|.    
 Frog   171 PWGFPTMPTDPSEIRSPPTWVKALAAVLG-RSN------PLAVVRAAGPWGPGLVQRFRPD---- 224

  Fly   290 DHHFPVWEKWLELLEESG----YFHIQATKPDTIGAALTSSPVGLASYILEKFQTCTNP------ 344
                 :..|:.|..|:..    .:|..|..|....|..|         ::|:|.....|      
 Frog   225 -----LKRKFQEYFEDDTIMEYIYHCNAQTPSGESAFKT---------MMERFGWAKRPMMSRIN 275

  Fly   345 GLKQDFGAIVTVFGLEAVLD 364
            .:.:|. .|..::|.|..:|
 Frog   276 QIPKDL-PITFIYGAETWID 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 20/83 (24%)
Abhydrolase 135..>251 CDD:304388 32/130 (25%)
abhd4NP_001017287.1 Abhydrolase 54..>169 CDD:304388 35/143 (24%)
MhpC 68..336 CDD:223669 56/275 (20%)
Abhydrolase <141..211 CDD:304388 14/85 (16%)
DHR2_DOCK <230..>338 CDD:297424 15/75 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.