DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and Serhl2

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_008763997.1 Gene:Serhl2 / 500911 RGDID:1563386 Length:328 Species:Rattus norvegicus


Alignment Length:331 Identity:68/331 - (20%)
Similarity:119/331 - (35%) Gaps:88/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PLLLLHGWPGSVREFFDFIPMLTKHSNITDYAFEVVAPSLVGYGWSDAATRPG--FNAAEMATVM 218
            |:|.||||..:...|...||.|.|     |:.:  ||....|:|.|...: ||  :......:.:
  Rat    46 PVLCLHGWLDNANSFDKLIPFLPK-----DFCY--VAMDFGGHGLSTHYS-PGLPYYHHNFVSEV 102

  Fly   219 RNLMLRLGHKKFFIQGGDWGSIIGSNLATLYPENVIGYHSNMCVL-HTPLAI------------L 270
            |.::......:..:.|..:|.::|...|.::||.|    ..:.:| .|||.:            .
  Rat   103 RRVVSAFKWTRLSLLGHSFGGVVGGLFACMFPEMV----DKLILLDSTPLLMDLNEVENIMTYRR 163

  Fly   271 KGIY------------GSFFPEKYLPSRFFVDHHFPVWEKWLELLEESGYFHIQATKPDTIGAAL 323
            |.|.            |.|.||:.|......:.|         |.|:.|...:|        ...
  Rat   164 KNIEQTLKVEDSQKPPGIFSPEEMLHELLTKNSH---------LNEDCGELLLQ--------RGT 211

  Fly   324 TSSPVGLASYILEKFQTCTNPGLKQDF-GAIVTVFGLEAVLDNLMVYYLTNSATTAARFYLEN-V 386
            |....||   :|.:.|..:.|....|| |..:|:..|..:..::::....:......|   || :
  Rat   212 TKVAEGL---VLNRDQRLSWPQYSFDFMGKELTMHSLRRLQASVLIIKALDGYYDVRR---ENDL 270

  Fly   387 SKTYRDLQLDRVQSPVPMGCARFRFDLASVTDWQLRDKFPNLTHSMYFQQGSHFAALEMPAMLFN 451
            :|....|.||.::|.:     :.||....:                   .|:|:..:..|.::.:
  Rat   271 NKASFLLMLDILRSTL-----KERFQFVEI-------------------PGNHYIHMNKPQIVAD 311

  Fly   452 DFTAFV 457
            ...:|:
  Rat   312 IIRSFL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 6/8 (75%)
Abhydrolase 135..>251 CDD:304388 24/96 (25%)
Serhl2XP_008763997.1 MhpC 33..320 CDD:223669 68/331 (21%)
Abhydrolase_5 46..>155 CDD:289465 31/120 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.