DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and serhl

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_031755888.1 Gene:serhl / 493433 XenbaseID:XB-GENE-5751959 Length:309 Species:Xenopus tropicalis


Alignment Length:199 Identity:48/199 - (24%)
Similarity:81/199 - (40%) Gaps:42/199 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 LLLLHGWPGSVREFFDFIPMLTKHSNITDYAFEVVAPSLVGYGWSDAATRPG--FNAAEMATVMR 219
            :|.||||..:...|...||:|.:       .:..||....|:|.| :...||  ::..:......
 Frog    36 VLCLHGWLDNANSFNKLIPLLPQ-------GYHYVALDFTGHGLS-SHKPPGARYDFIDFVIDAY 92

  Fly   220 NLMLRLGHKKFFIQGGDWGSIIGSNLATLYPENVIGYHSNMCVLHTPLAILKGIYGSFFPEKYLP 284
            ..::.||.:|..:.|...|.::|:.||::|||.:    .|:.:|.|        || |:|:.   
 Frog    93 KALVALGREKVTVLGHSLGGLVGTLLASIYPEII----ENVILLDT--------YG-FYPQS--- 141

  Fly   285 SRFFVDHHFPVWEKWLELLEESGYFHI-----QATKPDTIGAALTSSPVGLASYILEKFQTCTNP 344
            |..|:.|           .::|...::     |..|..|.|.||....:...|..:|..:.....
 Frog   142 SHIFISH-----------FKDSILSYVCTDVAQVQKTYTPGDALQRLLIANKSLTVESVKILLQR 195

  Fly   345 GLKQ 348
            |.|:
 Frog   196 GTKE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 5/7 (71%)
Abhydrolase 135..>251 CDD:304388 25/95 (26%)
serhlXP_031755888.1 Abhydrolase_1 35..>134 CDD:395444 29/109 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.