DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and CG14717

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster


Alignment Length:317 Identity:55/317 - (17%)
Similarity:112/317 - (35%) Gaps:93/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RQELFNS---------FKQYKTEIQGLNIHYIHEKVSEEAKEKKHVYPLLLLHGWPGSVREFFDF 173
            ||.|..|         .:.:::.:||..:.|:.   ....:.:....|::::|....|:..:...
  Fly     3 RQRLLGSILSKGGAQVLRNFQSFVQGTRLEYVS---YTSPRNQMQAPPIVVMHDLNLSLESWRQV 64

  Fly   174 IPMLTK---HSNIT-DYAFEVVAPSLVGYGWSDAATRPGFNAAEMATVMR----NLMLRLGHKKF 230
            ...|::   ...|| |.....::|.:.|:.       |...||::..:|.    |.::.|||   
  Fly    65 AVNLSQVGLRQVITVDARNHGLSPYITGHS-------PMHLAADVEALMSHQRLNKIVALGH--- 119

  Fly   231 FIQGGDWGSIIGSNLATLYPENVIGYHSNMCVLHTPLAILKGIYGSFFPEKYLPSRFFVDHHFPV 295
                    .:.|..:.||             .|..|..:.:.|.....|.. :||.|::...  |
  Fly   120 --------GMGGRAMMTL-------------ALTQPQLVERVILVDITPAP-VPSNFYLTRQ--V 160

  Fly   296 WEKWLEL---------LEESGYF--------------------HIQATKPDTIGAALTSSPVGLA 331
            :|..|::         |.|...|                    :::..:.:|.|.|:....| |:
  Fly   161 FEMMLQVAPSIPSNLSLSEGRTFILPLFQDVVHDASELRRIIYNLRKMQDNTFGWAVNPQAV-LS 224

  Fly   332 SY--ILEKFQTCTNPGLKQDFGAIVTVFGLEAVLDNLMVYYLTNSATTAARFYLENV 386
            |:  ::..:: .|..||:...|.::.:.|.::      .:..|.|.....|::...|
  Fly   225 SWGEMMINYE-ATLGGLRPYMGEVLLIAGSQS------EFVTTTSIAVMQRYFPNTV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 9/55 (16%)
Abhydrolase 135..>251 CDD:304388 21/123 (17%)
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 50/292 (17%)
Abhydrolase_5 47..>165 CDD:289465 29/151 (19%)
Abhydrolase <249..301 CDD:304388 5/32 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.