DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and CG7632

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster


Alignment Length:304 Identity:63/304 - (20%)
Similarity:107/304 - (35%) Gaps:88/304 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 KHVYPLLLLHGWPGSVREFFDFIPMLTKHSNITDYAFEVVAPSLVGYG---WSDAATRPGFNAAE 213
            |||.|::.:|||..:...|....|:|..|.:.    ..:.||   |:|   |....|  .:::.:
  Fly    54 KHVRPIVGMHGWQDNAGTFDTLAPLLPSHLSF----LSIDAP---GHGLSSWLPPGT--SYHSID 109

  Fly   214 MATVMRNLMLRLGHKKFFIQGGDWGSIIGSNLATLYPENV---IGYHSNMCVLHTPLAILKGIYG 275
            :..:.|.||......|..|......||.|...:.|:|:.|   :|    :.||..|:...:||..
  Fly   110 LVLITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVG----LDVLKPPVRSARGIVD 170

  Fly   276 SFFPEKY-----LPSRFFVDHHFPVWEKWLELLEESGYFHIQATKPDTIGAALTSSPVGLASYIL 335
            | ..|:.     |..|.......|.:: |.:|:..   .|..:.|..:|.|         ..|:|
  Fly   171 S-LTERIESALKLERRLKSGSEPPAYD-WDQLVTR---LHEGSNKSVSIDA---------CKYLL 221

  Fly   336 EKFQTCTNPGLKQDFGAIVTVFGLEAVLDNLMVYYLTNSATTAARFYLENVSKTYRDLQLDRVQS 400
            ::  .| .|...:..                ..|:..::...::.||              .:..
  Fly   222 QR--NC-KPSTHEPH----------------KYYFSRDNRLKSSLFY--------------TLHQ 253

  Fly   401 PVPMGCARFRFDLASVTDWQLRDKFPNL----THSMYFQQGSHF 440
            .|||..||             |.|.|:|    ..:.|:::..:|
  Fly   254 EVPMEMAR-------------RIKCPHLFIKALQAPYYERKEYF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 7/12 (58%)
Abhydrolase 135..>251 CDD:304388 26/101 (26%)
CG7632NP_649302.1 MhpC 57..326 CDD:223669 60/301 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.